GGRNA Home | Help | Advanced search

2020-10-24 06:55:41, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_024040               1203 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens CUE domain containing 2 (CUEDC2), mRNA.
ACCESSION   NM_024040
VERSION     NM_024040.2  GI:148596995
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1203)
  AUTHORS   Zhang,W.N., Wang,L., Wang,Q., Luo,X., Fang,D.F., Chen,Y., Pan,X.,
            Man,J.H., Xia,Q., Jin,B.F., Li,W.H., Li,T., Liang,B., Chen,L.,
            Gong,W.L., Yu,M., Li,A.L., Zhou,T. and Li,H.Y.
  TITLE     CUEDC2 (CUE domain-containing 2) and SOCS3 (suppressors of cytokine
            signaling 3) cooperate to negatively regulate Janus kinase 1/signal
            transducers and activators of transcription 3 signaling
  JOURNAL   J. Biol. Chem. 287 (1), 382-392 (2012)
   PUBMED   22084247
  REMARK    GeneRIF: a new biological activity for CUEDC2 as the regulator of
            JAK1/STAT3 signaling and the mechanism by which SOCS3 has been
            linked to suppression of the JAK/STAT pathway
REFERENCE   2  (bases 1 to 1203)
  AUTHORS   Gao,Y.F., Li,T., Chang,Y., Wang,Y.B., Zhang,W.N., Li,W.H., He,K.,
            Mu,R., Zhen,C., Man,J.H., Pan,X., Li,T., Chen,L., Yu,M., Liang,B.,
            Chen,Y., Xia,Q., Zhou,T., Gong,W.L., Li,A.L., Li,H.Y. and
            Zhang,X.M.
  TITLE     Cdk1-phosphorylated CUEDC2 promotes spindle checkpoint inactivation
            and chromosomal instability
  JOURNAL   Nat. Cell Biol. 13 (8), 924-933 (2011)
   PUBMED   21743465
  REMARK    GeneRIF: CUEDC2 is a cell-cycle regulator that promotes spindle
            checkpoint inactivation and releases APC/C from checkpoint
            inhibition. CUEDC2 is phosphorylated by Cdk1 during mitosis.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1203)
  AUTHORS   Pan,X., Zhou,T., Tai,Y.H., Wang,C., Zhao,J., Cao,Y., Chen,Y.,
            Zhang,P.J., Yu,M., Zhen,C., Mu,R., Bai,Z.F., Li,H.Y., Li,A.L.,
            Liang,B., Jian,Z., Zhang,W.N., Man,J.H., Gao,Y.F., Gong,W.L.,
            Wei,L.X. and Zhang,X.M.
  TITLE     Elevated expression of CUEDC2 protein confers endocrine resistance
            in breast cancer
  JOURNAL   Nat. Med. 17 (6), 708-714 (2011)
   PUBMED   21572428
  REMARK    GeneRIF: key factor in endocrine resistance in breast cancer
REFERENCE   4  (bases 1 to 1203)
  AUTHORS   Zhang,P.J., Zhao,J., Li,H.Y., Man,J.H., He,K., Zhou,T., Pan,X.,
            Li,A.L., Gong,W.L., Jin,B.F., Xia,Q., Yu,M., Shen,B.F. and
            Zhang,X.M.
  TITLE     CUE domain containing 2 regulates degradation of progesterone
            receptor by ubiquitin-proteasome
  JOURNAL   EMBO J. 26 (7), 1831-1842 (2007)
   PUBMED   17347654
  REMARK    GeneRIF: These results identify a key post-translational mechanism
            that controls progesterone receptor protein levels and for the
            first time provide an important insight into the function of CUEDC2
            in breast cancer proliferation.
REFERENCE   5  (bases 1 to 1203)
  AUTHORS   Grupe,A., Li,Y., Rowland,C., Nowotny,P., Hinrichs,A.L., Smemo,S.,
            Kauwe,J.S., Maxwell,T.J., Cherny,S., Doil,L., Tacey,K., van
            Luchene,R., Myers,A., Wavrant-De Vrieze,F., Kaleem,M.,
            Hollingworth,P., Jehu,L., Foy,C., Archer,N., Hamilton,G.,
            Holmans,P., Morris,C.M., Catanese,J., Sninsky,J., White,T.J.,
            Powell,J., Hardy,J., O'Donovan,M., Lovestone,S., Jones,L.,
            Morris,J.C., Thal,L., Owen,M., Williams,J. and Goate,A.
  TITLE     A scan of chromosome 10 identifies a novel locus showing strong
            association with late-onset Alzheimer disease
  JOURNAL   Am. J. Hum. Genet. 78 (1), 78-88 (2006)
   PUBMED   16385451
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   6  (bases 1 to 1203)
  AUTHORS   Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J.,
            Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and
            Kim,N.S.
  TITLE     Transcriptome analysis of human gastric cancer
  JOURNAL   Mamm. Genome 16 (12), 942-954 (2005)
   PUBMED   16341674
REFERENCE   7  (bases 1 to 1203)
  AUTHORS   Deloukas,P., Earthrowl,M.E., Grafham,D.V., Rubenfield,M.,
            French,L., Steward,C.A., Sims,S.K., Jones,M.C., Searle,S.,
            Scott,C., Howe,K., Hunt,S.E., Andrews,T.D., Gilbert,J.G.,
            Swarbreck,D., Ashurst,J.L., Taylor,A., Battles,J., Bird,C.P.,
            Ainscough,R., Almeida,J.P., Ashwell,R.I., Ambrose,K.D.,
            Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Bates,K.,
            Beasley,H., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D.C.,
            Burrill,W., Burton,J., Cahill,P., Camire,D., Carter,N.P.,
            Chapman,J.C., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S., Corby,N.,
            Coulson,A., Dhami,P., Dutta,I., Dunn,M., Faulkner,L., Frankish,A.,
            Frankland,J.A., Garner,P., Garnett,J., Gribble,S., Griffiths,C.,
            Grocock,R., Gustafson,E., Hammond,S., Harley,J.L., Hart,E.,
            Heath,P.D., Ho,T.P., Hopkins,B., Horne,J., Howden,P.J., Huckle,E.,
            Hynds,C., Johnson,C., Johnson,D., Kana,A., Kay,M., Kimberley,A.M.,
            Kershaw,J.K., Kokkinaki,M., Laird,G.K., Lawlor,S., Lee,H.M.,
            Leongamornlert,D.A., Laird,G., Lloyd,C., Lloyd,D.M., Loveland,J.,
            Lovell,J., McLaren,S., McLay,K.E., McMurray,A.,
            Mashreghi-Mohammadi,M., Matthews,L., Milne,S., Nickerson,T.,
            Nguyen,M., Overton-Larty,E., Palmer,S.A., Pearce,A.V., Peck,A.I.,
            Pelan,S., Phillimore,B., Porter,K., Rice,C.M., Rogosin,A.,
            Ross,M.T., Sarafidou,T., Sehra,H.K., Shownkeen,R., Skuce,C.D.,
            Smith,M., Standring,L., Sycamore,N., Tester,J., Thorpe,A.,
            Torcasso,W., Tracey,A., Tromans,A., Tsolas,J., Wall,M., Walsh,J.,
            Wang,H., Weinstock,K., West,A.P., Willey,D.L., Whitehead,S.L.,
            Wilming,L., Wray,P.W., Young,L., Chen,Y., Lovering,R.C.,
            Moschonas,N.K., Siebert,R., Fechtel,K., Bentley,D., Durbin,R.,
            Hubbard,T., Doucette-Stamm,L., Beck,S., Smith,D.R. and Rogers,J.
  TITLE     The DNA sequence and comparative analysis of human chromosome 10
  JOURNAL   Nature 429 (6990), 375-381 (2004)
   PUBMED   15164054
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BM756951.1, BC000262.1, CX165866.1 and BF002772.1.
            On Jun 5, 2007 this sequence version replaced gi:13128995.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC000262.1, AL527504.3 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-70                BM756951.1         1-70
            71-829              BC000262.1         1-759
            830-904             CX165866.1         714-788
            905-1192            BC000262.1         835-1122
            1193-1203           BF002772.1         1-11                c
FEATURES             Location/Qualifiers
     source          1..1203
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q24.32"
     gene            1..1203
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /note="CUE domain containing 2"
                     /db_xref="GeneID:79004"
                     /db_xref="HGNC:28352"
                     /db_xref="MIM:614142"
     exon            1..141
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    92..94
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /note="upstream in-frame stop codon"
     exon            142..225
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     CDS             152..1015
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /codon_start=1
                     /product="CUE domain-containing protein 2"
                     /protein_id="NP_076945.2"
                     /db_xref="GI:148596996"
                     /db_xref="CCDS:CCDS41566.1"
                     /db_xref="GeneID:79004"
                     /db_xref="HGNC:28352"
                     /db_xref="MIM:614142"
                     /translation="
MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAPKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
"
     misc_feature    479..481
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9H467.1); phosphorylation site"
     misc_feature    596..709
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /note="CUE domain; Region: CUE; cl02655"
                     /db_xref="CDD:207689"
     exon            226..369
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     exon            370..431
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     STS             392..789
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /standard_name="G73121"
                     /db_xref="UniSTS:231386"
     exon            432..562
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     variation       502
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044476"
     variation       540
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11550025"
     exon            563..745
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     exon            746..807
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     STS             770..1012
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /standard_name="MARC_7165-7166:996687578:1"
                     /db_xref="UniSTS:269719"
     variation       799
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3210927"
     exon            808..868
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     exon            869..1196
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /inference="alignment:Splign:1.39.8"
     STS             990..1178
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /standard_name="RH47391"
                     /db_xref="UniSTS:81197"
     variation       1044
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12558"
     STS             1052..1181
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /standard_name="SGC33233"
                     /db_xref="UniSTS:9565"
     STS             1052..1153
                     /gene="CUEDC2"
                     /gene_synonym="bA18I14.5; C10orf66"
                     /standard_name="SHGC-34547"
                     /db_xref="UniSTS:34389"
ORIGIN      
aacttgcccttctcaaacatggccgccacggcgcctctggaagggaaccgctctgggccccgcctttgatctcgttggtggggctgggggatgagagctgcaccgcgcgggacaagtcgccggcggcgcccgacggagcagaagagagagcatggagctggagaggatcgtcagtgcagccctccttgcctttgtccagacacacctcccggaggccgacctcagtggcttggatgaggtcatcttctcctatgtgcttggggtcctggaggacctgggcccctcgggcccatcagaggagaacttcgatatggaggctttcactgagatgatggaggcctatgtgcctggcttcgcccacatccccaggggcacaataggggacatgatgcagaagctctcagggcagctgagcgatgccaggaacaaagagaacctgcaaccgcagagctctggtgtccaaggtcaggtgcccatctccccagagcccctgcagcggcccgaaatgctcaaagaagagactaggtcttcggctgctgctgctgcagacacccaagatgaggcaactggcgctgaggaggagcttctgccaggggtggatgtactcctggaggtgttccctacctgttcggtggagcaggcccagtgggtgctggccaaagctcggggggacttggaagaagctgtgcagatgctggtagagggaaaggaagaggggcctgcagcctgggagggccccaaccaggacctgcccagacgcctcagaggcccccaaaaggatgagctgaagtccttcatcctgcagaagtacatgatggtggatagcgcagaggatcagaagattcaccggcccatggctcccaaggaggcccccaagaagctgatccgatacatcgacaaccaggtagtgagcaccaaaggggagcgattcaaagatgtgcggaaccctgaggccgaggagatgaaggccacatacatcaacctcaagccagccagaaagtaccgcttccattgaggcactcgccggactctgcccgagccttctaggctcagatcccagagggatgcaggagccctatacccctacacaggggccccctaactcctgtcccccttctctactcctttgctccatagtgttaacctactctcggagctgcctccatgggcacagtaaaggtggcccaaggaaggtgaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:79004 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:79004 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:79004 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
            GeneID:79004 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.