Home |
Help |
Advanced search
2024-04-25 22:18:04, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_023079 3137 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens ubiquitin-conjugating enzyme E2Z (UBE2Z), mRNA.
ACCESSION NM_023079 XM_941930 XM_945544 XM_945547 XM_945549
VERSION NM_023079.4 GI:302191680
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3137)
AUTHORS Schunkert,H., Konig,I.R., Kathiresan,S., Reilly,M.P., Assimes,T.L.,
Holm,H., Preuss,M., Stewart,A.F., Barbalic,M., Gieger,C.,
Absher,D., Aherrahrou,Z., Allayee,H., Altshuler,D., Anand,S.S.,
Andersen,K., Anderson,J.L., Ardissino,D., Ball,S.G.,
Balmforth,A.J., Barnes,T.A., Becker,D.M., Becker,L.C., Berger,K.,
Bis,J.C., Boekholdt,S.M., Boerwinkle,E., Braund,P.S., Brown,M.J.,
Burnett,M.S., Buysschaert,I., Carlquist,J.F., Chen,L., Cichon,S.,
Codd,V., Davies,R.W., Dedoussis,G., Dehghan,A., Demissie,S.,
Devaney,J.M., Diemert,P., Do,R., Doering,A., Eifert,S.,
Mokhtari,N.E., Ellis,S.G., Elosua,R., Engert,J.C., Epstein,S.E., de
Faire,U., Fischer,M., Folsom,A.R., Freyer,J., Gigante,B.,
Girelli,D., Gretarsdottir,S., Gudnason,V., Gulcher,J.R.,
Halperin,E., Hammond,N., Hazen,S.L., Hofman,A., Horne,B.D.,
Illig,T., Iribarren,C., Jones,G.T., Jukema,J.W., Kaiser,M.A.,
Kaplan,L.M., Kastelein,J.J., Khaw,K.T., Knowles,J.W., Kolovou,G.,
Kong,A., Laaksonen,R., Lambrechts,D., Leander,K., Lettre,G., Li,M.,
Lieb,W., Loley,C., Lotery,A.J., Mannucci,P.M., Maouche,S.,
Martinelli,N., McKeown,P.P., Meisinger,C., Meitinger,T.,
Melander,O., Merlini,P.A., Mooser,V., Morgan,T., Muhleisen,T.W.,
Muhlestein,J.B., Munzel,T., Musunuru,K., Nahrstaedt,J.,
Nelson,C.P., Nothen,M.M., Olivieri,O., Patel,R.S., Patterson,C.C.,
Peters,A., Peyvandi,F., Qu,L., Quyyumi,A.A., Rader,D.J.,
Rallidis,L.S., Rice,C., Rosendaal,F.R., Rubin,D., Salomaa,V.,
Sampietro,M.L., Sandhu,M.S., Schadt,E., Schafer,A., Schillert,A.,
Schreiber,S., Schrezenmeir,J., Schwartz,S.M., Siscovick,D.S.,
Sivananthan,M., Sivapalaratnam,S., Smith,A., Smith,T.B.,
Snoep,J.D., Soranzo,N., Spertus,J.A., Stark,K., Stirrups,K.,
Stoll,M., Tang,W.H., Tennstedt,S., Thorgeirsson,G.,
Thorleifsson,G., Tomaszewski,M., Uitterlinden,A.G., van Rij,A.M.,
Voight,B.F., Wareham,N.J., Wells,G.A., Wichmann,H.E., Wild,P.S.,
Willenborg,C., Witteman,J.C., Wright,B.J., Ye,S., Zeller,T.,
Ziegler,A., Cambien,F., Goodall,A.H., Cupples,L.A., Quertermous,T.,
Marz,W., Hengstenberg,C., Blankenberg,S., Ouwehand,W.H., Hall,A.S.,
Deloukas,P., Thompson,J.R., Stefansson,K., Roberts,R.,
Thorsteinsdottir,U., O'Donnell,C.J., McPherson,R., Erdmann,J. and
Samani,N.J.
CONSRTM Cardiogenics; CARDIoGRAM Consortium
TITLE Large-scale association analysis identifies 13 new susceptibility
loci for coronary artery disease
JOURNAL Nat. Genet. 43 (4), 333-338 (2011)
PUBMED 21378990
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 3137)
AUTHORS Gu,X., Zhao,F., Zheng,M., Fei,X., Chen,X., Huang,S., Xie,Y. and
Mao,Y.
TITLE Cloning and characterization of a gene encoding the human putative
ubiquitin conjugating enzyme E2Z (UBE2Z)
JOURNAL Mol. Biol. Rep. 34 (3), 183-188 (2007)
PUBMED 17160626
REMARK GeneRIF: UBE2Z was widely expressed in human tissues and is located
on chromosome 17q21.
REFERENCE 3 (bases 1 to 3137)
AUTHORS Jin,J., Li,X., Gygi,S.P. and Harper,J.W.
TITLE Dual E1 activation systems for ubiquitin differentially regulate E2
enzyme charging
JOURNAL Nature 447 (7148), 1135-1138 (2007)
PUBMED 17597759
REMARK GeneRIF: In tissue culture cells, Uba6 is required for charging a
previously uncharacterized Uba6-specific E2 (Use1), whereas Ube1 is
required for charging the cell-cycle E2s Cdc34A and Cdc34B
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AC091133.11, BC015890.1, AL713782.1, AK122770.1 and AA845421.1.
On Aug 5, 2010 this sequence version replaced gi:150417998.
Summary: This gene encodes an enzyme which ubiquitinates proteins
which participate in signaling pathways and apoptosis. [provided by
RefSeq, Feb 2012].
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
##Evidence-Data-START##
Transcript exon combination :: BC015890.1, AK122770.1, BC015890.1
[ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-132 AC091133.11 132267-132398 c
133-980 BC015890.1 1-848
981-1328 AL713782.1 137-484
1329-2405 AK122770.1 1227-2303
2406-3122 BC015890.1 2274-2990
3123-3137 AA845421.1 1-15 c
FEATURES Location/Qualifiers
source 1..3137
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17q21.32"
gene 1..3137
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/note="ubiquitin-conjugating enzyme E2Z"
/db_xref="GeneID:65264"
/db_xref="HGNC:25847"
/db_xref="MIM:611362"
exon 1..452
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/inference="alignment:Splign:1.39.8"
variation 27
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace=""
/replace="g"
/db_xref="dbSNP:71144541"
variation 32
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="c"
/db_xref="dbSNP:200920680"
CDS 136..1200
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/EC_number="6.3.2.19"
/note="UBA6-specific enzyme E2; ubiquitin-protein ligase
Z; ubiquitin carrier protein Z; uba6-specific E2
conjugating enzyme 1"
/codon_start=1
/product="ubiquitin-conjugating enzyme E2 Z"
/protein_id="NP_075567.2"
/db_xref="GI:150417999"
/db_xref="CCDS:CCDS11540.2"
/db_xref="GeneID:65264"
/db_xref="HGNC:25847"
/db_xref="MIM:611362"
/translation="
MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV
"
misc_feature 442..>744
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc)
domain. This is part of the ubiquitin-mediated protein
degradation pathway in which a thiol-ester linkage forms
between a conserved cysteine and the C-terminus of
ubiquitin and complexes with ubiquitin...; Region: UBCc;
cd00195"
/db_xref="CDD:29157"
misc_feature order(610..615,739..744)
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/note="E3 interaction residues; other site"
/db_xref="CDD:29157"
misc_feature order(643..645,661..663,673..678,682..684,694..702,
706..711,733..738)
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/note="Ub thioester intermediate interaction residues;
other site"
/db_xref="CDD:29157"
misc_feature 697..699
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/note="active site cysteine"
/db_xref="CDD:29157"
variation 186
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="g"
/replace="t"
/db_xref="dbSNP:371282577"
exon 453..525
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/inference="alignment:Splign:1.39.8"
exon 526..713
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/inference="alignment:Splign:1.39.8"
variation 603
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372197104"
variation 626
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:375589561"
variation 683
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:144649420"
exon 714..825
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/inference="alignment:Splign:1.39.8"
variation 731
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:14421"
variation 798
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="g"
/db_xref="dbSNP:138545057"
variation 816
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="g"
/db_xref="dbSNP:149295614"
exon 826..938
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/inference="alignment:Splign:1.39.8"
variation 876
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:57077857"
variation 882
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="c"
/db_xref="dbSNP:374805356"
variation 920
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="c"
/db_xref="dbSNP:148048743"
variation 936
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:199614205"
exon 939..1029
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/inference="alignment:Splign:1.39.8"
variation 957
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:143741978"
variation 972
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:147448373"
variation 981
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:1058018"
variation 982
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:183767062"
variation 1023
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:369952699"
exon 1030..3126
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/inference="alignment:Splign:1.39.8"
variation 1038
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:376224551"
variation 1050
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200801877"
variation 1109
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="c"
/db_xref="dbSNP:1058017"
variation 1158
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="c"
/db_xref="dbSNP:145854510"
variation 1202
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:370323738"
variation 1223
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:375182716"
variation 1230
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="g"
/db_xref="dbSNP:373393504"
variation 1427
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:2088138"
variation 1465..1466
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace=""
/replace="c"
/db_xref="dbSNP:371315163"
variation 1466
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:148572493"
variation 1722
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:78183148"
variation 1897
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:15563"
variation 2085
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:3744611"
variation 2119..2120
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace=""
/replace="g"
/db_xref="dbSNP:35412283"
STS 2139..2380
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/standard_name="A009L01"
/db_xref="UniSTS:71484"
STS 2139..2380
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/standard_name="G32634"
/db_xref="UniSTS:117217"
variation 2156
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="g"
/replace="t"
/db_xref="dbSNP:114544818"
variation 2213
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="g"
/replace="t"
/db_xref="dbSNP:1057897"
STS 2214..2334
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/standard_name="RH17824"
/db_xref="UniSTS:73832"
variation 2246
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="g"
/replace="t"
/db_xref="dbSNP:55685312"
variation 2262
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:28384242"
variation 2292
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1057902"
variation 2388
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:183523260"
variation 2405..2406
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace=""
/replace="a"
/db_xref="dbSNP:201929916"
variation 2483
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:113236693"
variation 2498
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:7221215"
variation 2602
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:192998454"
variation 2728
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="g"
/replace="t"
/db_xref="dbSNP:375342301"
variation 2770..2771
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace=""
/replace="tga"
/db_xref="dbSNP:144120233"
variation 2771..2772
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace=""
/replace="gag"
/replace="tga"
/db_xref="dbSNP:370886107"
variation 2774..2775
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace=""
/replace="tga"
/db_xref="dbSNP:71661305"
variation 2774
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="t"
/db_xref="dbSNP:113522189"
variation 2777
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:113446783"
variation 2790
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:185251725"
variation 2802
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:145544916"
variation 2862
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:147694058"
variation 2917
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="c"
/db_xref="dbSNP:3205390"
variation 3054
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:189626966"
variation 3075..3076
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace=""
/replace="t"
/db_xref="dbSNP:71369239"
variation 3084
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="c"
/db_xref="dbSNP:200294094"
variation 3089
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="c"
/replace="t"
/db_xref="dbSNP:11557620"
variation 3120
/gene="UBE2Z"
/gene_synonym="HOYS7; USE1"
/replace="a"
/replace="g"
/db_xref="dbSNP:3179960"
ORIGIN
agcaccgtctgggctgtggaagcggagggggtggggacactctggcccggttctcggtggtgcgggagcgggcgggagcagcggccgctctggtcggcggacgtgctgccgagtagtcccggaagcgaagcagcgatggcggagagtccgactgaggaggcggcaacggcgggcgccggggcggcgggccccggggcgagcagcgttgctggtgttgttggcgttagcggcagcggcggcgggttcgggccgcctttcctgccggatgtgtgggcggcggcggcggcagcgggcggggccgggggcccggggagcggcctggctccgctgcccgggctcccgccctcagccgctgcccacggggccgcgctgcttagccactgggaccccacgctcagctccgactgggacggcgagcgcaccgcgccgcagtgtctactccggatcaagcgggatatcatgtccatttataaggagcctcctccaggaatgttcgttgtacctgatactgttgacatgactaagattcatgcattgatcacaggcccatttgacactccttatgaagggggtttcttcctgttcgtgtttcggtgtccgcccgactatcccatccacccacctcgggtcaaactgatgacaacgggcaataacacagtgaggtttaaccccaacttctaccgcaatgggaaagtctgcttgagtattctaggtacatggactggacctgcctggagcccagcccagagcatctcctcagtgctcatctctatccagtccctgatgactgagaacccctatcacaatgagcccggctttgaacaggagagacatccaggagacagcaaaaactataatgaatgtatccggcacgagaccatcagagttgcagtctgtgacatgatggaaggaaagtgtccctgtcctgaacccctacgaggggtgatggagaagtcctttctggagtattacgacttctacgaggtggcctgcaaagatcgcctgcaccttcaaggccaaactatgcaggacccttttggagagaagcggggccactttgactaccagtccctcttgatgcgcctgggactgatacgtcagaaagtgctggagaggctccataatgagaatgcagaaatggactctgatagcagttcatctgggacagagacagaccttcatgggagcctgagggtttagaccctgctcccatctccccttcccccactcaagagtcccagcagaatcccttccccccaccccagggatggagaggcactgtgtatctccctccagactcgaagtcatcctgcaagatggcaagaaccaagcaagctccgatcccagggtgtgggagtgggggcctgttcccggtctgacctccttggcactggagcatctggggcttcgttcatccattcatcccgtatcaggggccaaggtacctttacaggagcacctagagcgagggcctttggcaaaaacaaaacaaccaacacacctctccacagggccagctccttagggataagtggaagatggaaattgcaattccaagagggagtgtgcccaaatgatttatggggatacctggaagggagcttggggtgggggctgtctgtgacacttaagcagtctgggtggttgtctatttgtctgtcttcagtcttgaagcagggcttcccaatgcccttttcctccctgccttccttcccccattatttcccacaggccagcataattttgtttttcctaatttatagtcactgttctagacagaccaaagagaaggaacagtggtggagtctaggctgctgatcagtaagctttacctagcacctgagcacctttctcccctcccctctttcctcacccttttctagatgtaagacagaaagtaaatgtgactgggacttaaccaaggtcttggtaaagcctgcatggcaccgtaagaagctgaaaatactgtttgttcccgcaatcactgatttgaaaagttcccaacacaggcagctgctgtgtatatgggattagagccactacatagaatagtctcttacagattttcataaatactagtcacaataagggtatttttcttgggggtggagtaagggggagactgatgctagtccttgttgtattttgttgggctgtccttgtgtattttcaccccagcctgtagtcctcctcacttcaaccccagggatttttggggagcaagggtagccaatggcagagggggttggggctgggactctggaggctcctccccttctttctcttccttccgcctcccccgtgcccccagctgctcttgtcactgtctctgatgggtatttgcctggctttgttgcttctctatctgtatttagctgcagtgatcctttagctggttggctcagaaaaaaaaaaatgtgctttaggtgccctgtaatcctgggcatcaagggaatccatccttcccctttttgatatgttctccccgtacttccagatttattgttatggctcccagtgggtattggcgattcttgtgatgcagggcctcagtcagtgtccagccatgcataagggagaggatagtgtgtacctgccctgccctctgctatgaaggtctctgccttgtggatcatgggactccccttggaggatctgtgcaaaggggggctgggcacaaaggagaatgtcctatttgggagggcaggaagcaaaggaactggacagggattggtgggcttggggaacggaagtttatcttggatacccttgaagaggctgggtctcttcacatgaagatcgaaaagggaccctgcttccaatttccctcttccattcctcgagctactccagggcttagaagaatgctcttggtctgtgggtccagtgttgtctgtcatccatttaagtgttcccactttcaagtgacaatcctctccttggccctgccatagggcagagcatgtctggcatagcagcctgacttttatgccctaatcttgagttgaggaaatatatgcacaggagtcaaagagatgtctttatatctgactgtatataaatgaagtttttttgttttttttgttttcctttttggtgcaataaagtttgttttggcagaaggagaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:65264 -> Molecular function: GO:0004842 [ubiquitin-protein ligase activity] evidence: IEA
GeneID:65264 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:65264 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:65264 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:65264 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:65264 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_075567 -> EC 6.3.2.19
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.