GGRNA Home | Help | Advanced search

2019-03-23 03:53:09, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_022909               1405 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens centromere protein H (CENPH), mRNA.
ACCESSION   NM_022909
VERSION     NM_022909.3  GI:21264590
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1405)
  AUTHORS   He,W.L., Li,Y.H., Yang,D.J., Song,W., Chen,X.L., Liu,F.K., Wang,Z.,
            Li,W., Chen,W., Chen,C.Y., He,Y.L. and Zhan,W.H.
  TITLE     Combined evaluation of centromere protein H and Ki-67 as prognostic
            biomarker for patients with gastric carcinoma
  JOURNAL   Eur J Surg Oncol 39 (2), 141-149 (2013)
   PUBMED   22999412
  REMARK    GeneRIF: High expression of CENP-H in gastric cancer indicates poor
            prognosis and Survivin may mediate its procancer role.
REFERENCE   2  (bases 1 to 1405)
  AUTHORS   Zhao,W.F., Wang,H.B., Xie,B., Hu,L.J., Xu,L.H., Kuang,B.H., Li,M.Z.
            and Zhang,X.
  TITLE     Sp1 and Sp3 are involved in the full transcriptional activity of
            centromere protein H in human nasopharyngeal carcinoma cells
  JOURNAL   FEBS J. 279 (15), 2714-2726 (2012)
   PUBMED   22682030
  REMARK    GeneRIF: Sp1 and Sp3 bind to the CENPH minimal promoter and
            function as a regulator of the transcription of CENPH in
            nasopharyngeal carcinomas.
REFERENCE   3  (bases 1 to 1405)
  AUTHORS   Wang,J.X., Zhang,Y.Y., Yu,X.M., Jin,T. and Pan,X.L.
  TITLE     Role of centromere protein H and Ki67 in relapse-free survival of
            patients after primary surgery for hypopharyngeal cancer
  JOURNAL   Asian Pac. J. Cancer Prev. 13 (3), 821-825 (2012)
   PUBMED   22631655
  REMARK    GeneRIF: upregulated CENP-H and Ki67 levels are significantly
            associated with short relapse-free survival in hypopharyngeal
            squamous cell carcinoma (HSSC); these factors may be predictors of
            a relapsing phenotype in HSSC cases
REFERENCE   4  (bases 1 to 1405)
  AUTHORS   Liao,W.T., Feng,Y., Li,M.L., Liu,G.L., Li,M.Z., Zeng,M.S. and
            Song,L.B.
  TITLE     Overexpression of centromere protein H is significantly associated
            with breast cancer progression and overall patient survival
  JOURNAL   Chin J Cancer 30 (9), 627-637 (2011)
   PUBMED   21880184
  REMARK    GeneRIF: Breast cancer patients with high CENP-H expression had
            short overall survival. CENP-H expression was related with clinical
            stage.
REFERENCE   5  (bases 1 to 1405)
  AUTHORS   Okada,M., Okawa,K., Isobe,T. and Fukagawa,T.
  TITLE     CENP-H-containing complex facilitates centromere deposition of
            CENP-A in cooperation with FACT and CHD1
  JOURNAL   Mol. Biol. Cell 20 (18), 3986-3995 (2009)
   PUBMED   19625449
  REMARK    GeneRIF: CENP-H-containing complex facilitates deposition of newly
            synthesized CENP-A into centromeric chromatin in cooperation with
            FACT and CHD1.
REFERENCE   6  (bases 1 to 1405)
  AUTHORS   Mikami,Y., Hori,T., Kimura,H. and Fukagawa,T.
  TITLE     The functional region of CENP-H interacts with the Nuf2 complex
            that localizes to centromere during mitosis
  JOURNAL   Mol. Cell. Biol. 25 (5), 1958-1970 (2005)
   PUBMED   15713649
REFERENCE   7  (bases 1 to 1405)
  AUTHORS   Obuse,C., Iwasaki,O., Kiyomitsu,T., Goshima,G., Toyoda,Y. and
            Yanagida,M.
  TITLE     A conserved Mis12 centromere complex is linked to heterochromatic
            HP1 and outer kinetochore protein Zwint-1
  JOURNAL   Nat. Cell Biol. 6 (11), 1135-1141 (2004)
   PUBMED   15502821
REFERENCE   8  (bases 1 to 1405)
  AUTHORS   Obuse,C., Yang,H., Nozaki,N., Goto,S., Okazaki,T. and Yoda,K.
  TITLE     Proteomics analysis of the centromere complex from HeLa interphase
            cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of
            the CEN-complex, while BMI-1 is transiently co-localized with the
            centromeric region in interphase
  JOURNAL   Genes Cells 9 (2), 105-120 (2004)
   PUBMED   15009096
REFERENCE   9  (bases 1 to 1405)
  AUTHORS   Saffery,R., Sumer,H., Hassan,S., Wong,L.H., Craig,J.M.,
            Todokoro,K., Anderson,M., Stafford,A. and Choo,K.H.
  TITLE     Transcription within a functional human centromere
  JOURNAL   Mol. Cell 12 (2), 509-516 (2003)
   PUBMED   14536089
REFERENCE   10 (bases 1 to 1405)
  AUTHORS   Sugata,N., Li,S., Earnshaw,W.C., Yen,T.J., Yoda,K., Masumoto,H.,
            Munekata,E., Warburton,P.E. and Todokoro,K.
  TITLE     Human CENP-H multimers colocalize with CENP-A and CENP-C at active
            centromere--kinetochore complexes
  JOURNAL   Hum. Mol. Genet. 9 (19), 2919-2926 (2000)
   PUBMED   11092768
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC015355.1.
            On May 30, 2002 this sequence version replaced gi:20070324.
            
            Summary: Centromere and kinetochore proteins play a critical role
            in centromere structure, kinetochore formation, and sister
            chromatid separation. The protein encoded by this gene colocalizes
            with inner kinetochore plate proteins CENP-A and CENP-C in both
            interphase and metaphase. It localizes outside of centromeric
            heterochromatin, where CENP-B is localized, and inside the
            kinetochore corona, where CENP-E is localized during prometaphase.
            It is thought that this protein can bind to itself, as well as to
            CENP-A, CENP-B or CENP-C. Multimers of the protein localize
            constitutively to the inner kinetochore plate and play an important
            role in the organization and function of the active
            centromere-kinetochore complex. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC015355.1, AK290746.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025083 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..1405
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="5"
                     /map="5p15.2"
     gene            1..1405
                     /gene="CENPH"
                     /note="centromere protein H"
                     /db_xref="GeneID:64946"
                     /db_xref="HGNC:17268"
                     /db_xref="HPRD:12029"
                     /db_xref="MIM:605607"
     exon            1..221
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       15
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111807131"
     variation       35
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371446712"
     variation       36
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370130299"
     variation       46
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373405242"
     CDS             88..831
                     /gene="CENPH"
                     /note="kinetochore protein CENP-H; interphase centromere
                     complex protein 35"
                     /codon_start=1
                     /product="centromere protein H"
                     /protein_id="NP_075060.1"
                     /db_xref="GI:12597655"
                     /db_xref="CCDS:CCDS3998.1"
                     /db_xref="GeneID:64946"
                     /db_xref="HGNC:17268"
                     /db_xref="HPRD:12029"
                     /db_xref="MIM:605607"
                     /translation="
MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
"
     misc_feature    493..810
                     /gene="CENPH"
                     /note="Centromere protein H (CENP-H); Region: CENP-H;
                     pfam05837"
                     /db_xref="CDD:191382"
     variation       90
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151237843"
     variation       99
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375968623"
     variation       101
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370933581"
     variation       107
                     /gene="CENPH"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375193070"
     variation       112
                     /gene="CENPH"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201912817"
     variation       180
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368213086"
     variation       192
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113792450"
     variation       217
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372857187"
     exon            222..277
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       223
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202100035"
     variation       243
                     /gene="CENPH"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:149837292"
     exon            278..326
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       320
                     /gene="CENPH"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377674570"
     variation       322
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200925138"
     variation       325
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145422621"
     exon            327..401
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       329
                     /gene="CENPH"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:182126192"
     variation       333
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373494215"
     variation       367
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376036036"
     variation       376
                     /gene="CENPH"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376726420"
     variation       387
                     /gene="CENPH"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201323177"
     exon            402..458
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       432
                     /gene="CENPH"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371312678"
     exon            459..522
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       511
                     /gene="CENPH"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199802169"
     exon            523..574
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       563
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116129735"
     variation       568
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113534604"
     exon            575..738
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       612
                     /gene="CENPH"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147701359"
     variation       632
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142524123"
     variation       649
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:114301971"
     variation       683
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150256446"
     variation       712
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138892809"
     exon            739..1389
                     /gene="CENPH"
                     /inference="alignment:Splign:1.39.8"
     variation       764
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200621400"
     variation       769
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372296878"
     variation       817
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375648256"
     variation       903..906
                     /gene="CENPH"
                     /replace=""
                     /replace="tgtc"
                     /db_xref="dbSNP:374838407"
     variation       914
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372930981"
     variation       941
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367681440"
     variation       1034..1036
                     /gene="CENPH"
                     /replace=""
                     /replace="ttg"
                     /db_xref="dbSNP:368362241"
     variation       1059
                     /gene="CENPH"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:60113639"
     variation       1071
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189415911"
     variation       1127
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:61743885"
     variation       1153
                     /gene="CENPH"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112703036"
     variation       1245
                     /gene="CENPH"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:111243827"
     variation       1275
                     /gene="CENPH"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75832464"
     polyA_signal    1370..1375
                     /gene="CENPH"
     polyA_site      1389
                     /gene="CENPH"
                     /experiment="experimental evidence, no additional details
                     recorded"
ORIGIN      
tttcccggcgtccatttagtggcgggaaaagcgaccttttctgagcgcgtttgcctgttgagtggtagcctttcccctcaaccagcaatggaggagcagccccagatgcaagacgccgacgagcccgcggactccggaggggaaggccgggcaggcgggccaccgcaggtcgccggcgcccaggcggcgtgcagcgaggaccgcatgaccctgctcctcaggctgagagcacagacaaaacaacaactcttagaatataaatcaatggttgatgcaagtgaagaaaaaactccagaacaaattatgcaagaaaagcaaatcgaagctaaaattgaagacctggaaaatgaaattgaagaggtaaaagttgcttttgagataaaaaagcttgcattagacaggatgagactttcaactgcacttaaaaaaaacctggagaaaattagcagacagtctagtgtgctcatggataacatgaaacacctattagagctaaataaattaataatgaaatcacagcaggaatcttgggatttagaggaaaaactgcttgatattagaaagaagagattgcaattaaaacaagcttcagaaagtaagcttttagaaatacagactgaaaagaacaaacagaagattgatttggacagtatggaaaactcagagaggataaagatcatacgacaaaacctacagatggagataaaaattactactgttattcaacatgtgttccagaaccttattttggggagtaaagtcaattgggcagaggatcctgcccttaaggaaattgttctgcagcttgagaagaatgttgacatgatgtaataagaattcatttctgacatattttacatttctggcaatctcaactcttatttggaatacttctgtgcatttgtctgtccaccgtaattttagaaaagcatatccataacgtttacagttgtagtacagttgtggttagttatttgtagtgggattgaaagtaatttttttctttttatatttctatatttagtttgtttttttgttgttgttgttttttgagatggagtctcgctttgttgcccagactggagggcagtggcgcgatctcggctcactgcaacctctgcctcccgggttcaagcagttctgcctcagcctcccaagtagctgtgactaaaggtgcacgccgccatgcccagctaattttttgtattttagtagagacggggtttcaccgtgttgcccaggctgctctcagaactcctgagctcaggcagtccaccgcctcggcctaccgaagtgctaggattacagacgtaagccaccgagcctggtctagtttgcattttttttctatcagttttataagttaagaaataaaaggaattaatgttaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:64946 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:64946 -> Molecular function: GO:0043515 [kinetochore binding] evidence: IDA
            GeneID:64946 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
            GeneID:64946 -> Biological process: GO:0006334 [nucleosome assembly] evidence: TAS
            GeneID:64946 -> Biological process: GO:0007059 [chromosome segregation] evidence: IEA
            GeneID:64946 -> Biological process: GO:0034080 [CENP-A containing nucleosome assembly at centromere] evidence: TAS
            GeneID:64946 -> Biological process: GO:0051301 [cell division] evidence: IEA
            GeneID:64946 -> Biological process: GO:0051383 [kinetochore organization] evidence: TAS
            GeneID:64946 -> Cellular component: GO:0000776 [kinetochore] evidence: IDA
            GeneID:64946 -> Cellular component: GO:0000776 [kinetochore] evidence: IMP
            GeneID:64946 -> Cellular component: GO:0000776 [kinetochore] evidence: NAS
            GeneID:64946 -> Cellular component: GO:0000777 [condensed chromosome kinetochore] evidence: IEA
            GeneID:64946 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:64946 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
            GeneID:64946 -> Cellular component: GO:0005829 [cytosol] evidence: TAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.