Home |
Help |
Advanced search
2024-04-19 14:41:15, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_022909 1405 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens centromere protein H (CENPH), mRNA.
ACCESSION NM_022909
VERSION NM_022909.3 GI:21264590
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1405)
AUTHORS He,W.L., Li,Y.H., Yang,D.J., Song,W., Chen,X.L., Liu,F.K., Wang,Z.,
Li,W., Chen,W., Chen,C.Y., He,Y.L. and Zhan,W.H.
TITLE Combined evaluation of centromere protein H and Ki-67 as prognostic
biomarker for patients with gastric carcinoma
JOURNAL Eur J Surg Oncol 39 (2), 141-149 (2013)
PUBMED 22999412
REMARK GeneRIF: High expression of CENP-H in gastric cancer indicates poor
prognosis and Survivin may mediate its procancer role.
REFERENCE 2 (bases 1 to 1405)
AUTHORS Zhao,W.F., Wang,H.B., Xie,B., Hu,L.J., Xu,L.H., Kuang,B.H., Li,M.Z.
and Zhang,X.
TITLE Sp1 and Sp3 are involved in the full transcriptional activity of
centromere protein H in human nasopharyngeal carcinoma cells
JOURNAL FEBS J. 279 (15), 2714-2726 (2012)
PUBMED 22682030
REMARK GeneRIF: Sp1 and Sp3 bind to the CENPH minimal promoter and
function as a regulator of the transcription of CENPH in
nasopharyngeal carcinomas.
REFERENCE 3 (bases 1 to 1405)
AUTHORS Wang,J.X., Zhang,Y.Y., Yu,X.M., Jin,T. and Pan,X.L.
TITLE Role of centromere protein H and Ki67 in relapse-free survival of
patients after primary surgery for hypopharyngeal cancer
JOURNAL Asian Pac. J. Cancer Prev. 13 (3), 821-825 (2012)
PUBMED 22631655
REMARK GeneRIF: upregulated CENP-H and Ki67 levels are significantly
associated with short relapse-free survival in hypopharyngeal
squamous cell carcinoma (HSSC); these factors may be predictors of
a relapsing phenotype in HSSC cases
REFERENCE 4 (bases 1 to 1405)
AUTHORS Liao,W.T., Feng,Y., Li,M.L., Liu,G.L., Li,M.Z., Zeng,M.S. and
Song,L.B.
TITLE Overexpression of centromere protein H is significantly associated
with breast cancer progression and overall patient survival
JOURNAL Chin J Cancer 30 (9), 627-637 (2011)
PUBMED 21880184
REMARK GeneRIF: Breast cancer patients with high CENP-H expression had
short overall survival. CENP-H expression was related with clinical
stage.
REFERENCE 5 (bases 1 to 1405)
AUTHORS Okada,M., Okawa,K., Isobe,T. and Fukagawa,T.
TITLE CENP-H-containing complex facilitates centromere deposition of
CENP-A in cooperation with FACT and CHD1
JOURNAL Mol. Biol. Cell 20 (18), 3986-3995 (2009)
PUBMED 19625449
REMARK GeneRIF: CENP-H-containing complex facilitates deposition of newly
synthesized CENP-A into centromeric chromatin in cooperation with
FACT and CHD1.
REFERENCE 6 (bases 1 to 1405)
AUTHORS Mikami,Y., Hori,T., Kimura,H. and Fukagawa,T.
TITLE The functional region of CENP-H interacts with the Nuf2 complex
that localizes to centromere during mitosis
JOURNAL Mol. Cell. Biol. 25 (5), 1958-1970 (2005)
PUBMED 15713649
REFERENCE 7 (bases 1 to 1405)
AUTHORS Obuse,C., Iwasaki,O., Kiyomitsu,T., Goshima,G., Toyoda,Y. and
Yanagida,M.
TITLE A conserved Mis12 centromere complex is linked to heterochromatic
HP1 and outer kinetochore protein Zwint-1
JOURNAL Nat. Cell Biol. 6 (11), 1135-1141 (2004)
PUBMED 15502821
REFERENCE 8 (bases 1 to 1405)
AUTHORS Obuse,C., Yang,H., Nozaki,N., Goto,S., Okazaki,T. and Yoda,K.
TITLE Proteomics analysis of the centromere complex from HeLa interphase
cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of
the CEN-complex, while BMI-1 is transiently co-localized with the
centromeric region in interphase
JOURNAL Genes Cells 9 (2), 105-120 (2004)
PUBMED 15009096
REFERENCE 9 (bases 1 to 1405)
AUTHORS Saffery,R., Sumer,H., Hassan,S., Wong,L.H., Craig,J.M.,
Todokoro,K., Anderson,M., Stafford,A. and Choo,K.H.
TITLE Transcription within a functional human centromere
JOURNAL Mol. Cell 12 (2), 509-516 (2003)
PUBMED 14536089
REFERENCE 10 (bases 1 to 1405)
AUTHORS Sugata,N., Li,S., Earnshaw,W.C., Yen,T.J., Yoda,K., Masumoto,H.,
Munekata,E., Warburton,P.E. and Todokoro,K.
TITLE Human CENP-H multimers colocalize with CENP-A and CENP-C at active
centromere--kinetochore complexes
JOURNAL Hum. Mol. Genet. 9 (19), 2919-2926 (2000)
PUBMED 11092768
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC015355.1.
On May 30, 2002 this sequence version replaced gi:20070324.
Summary: Centromere and kinetochore proteins play a critical role
in centromere structure, kinetochore formation, and sister
chromatid separation. The protein encoded by this gene colocalizes
with inner kinetochore plate proteins CENP-A and CENP-C in both
interphase and metaphase. It localizes outside of centromeric
heterochromatin, where CENP-B is localized, and inside the
kinetochore corona, where CENP-E is localized during prometaphase.
It is thought that this protein can bind to itself, as well as to
CENP-A, CENP-B or CENP-C. Multimers of the protein localize
constitutively to the inner kinetochore plate and play an important
role in the organization and function of the active
centromere-kinetochore complex. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC015355.1, AK290746.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025083 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..1405
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="5"
/map="5p15.2"
gene 1..1405
/gene="CENPH"
/note="centromere protein H"
/db_xref="GeneID:64946"
/db_xref="HGNC:17268"
/db_xref="HPRD:12029"
/db_xref="MIM:605607"
exon 1..221
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 15
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:111807131"
variation 35
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:371446712"
variation 36
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:370130299"
variation 46
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:373405242"
CDS 88..831
/gene="CENPH"
/note="kinetochore protein CENP-H; interphase centromere
complex protein 35"
/codon_start=1
/product="centromere protein H"
/protein_id="NP_075060.1"
/db_xref="GI:12597655"
/db_xref="CCDS:CCDS3998.1"
/db_xref="GeneID:64946"
/db_xref="HGNC:17268"
/db_xref="HPRD:12029"
/db_xref="MIM:605607"
/translation="
MEEQPQMQDADEPADSGGEGRAGGPPQVAGAQAACSEDRMTLLLRLRAQTKQQLLEYKSMVDASEEKTPEQIMQEKQIEAKIEDLENEIEEVKVAFEIKKLALDRMRLSTALKKNLEKISRQSSVLMDNMKHLLELNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
"
misc_feature 493..810
/gene="CENPH"
/note="Centromere protein H (CENP-H); Region: CENP-H;
pfam05837"
/db_xref="CDD:191382"
variation 90
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:151237843"
variation 99
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:375968623"
variation 101
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:370933581"
variation 107
/gene="CENPH"
/replace="g"
/replace="t"
/db_xref="dbSNP:375193070"
variation 112
/gene="CENPH"
/replace="c"
/replace="g"
/db_xref="dbSNP:201912817"
variation 180
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:368213086"
variation 192
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:113792450"
variation 217
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:372857187"
exon 222..277
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 223
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:202100035"
variation 243
/gene="CENPH"
/replace="a"
/replace="t"
/db_xref="dbSNP:149837292"
exon 278..326
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 320
/gene="CENPH"
/replace="a"
/replace="t"
/db_xref="dbSNP:377674570"
variation 322
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:200925138"
variation 325
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:145422621"
exon 327..401
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 329
/gene="CENPH"
/replace="a"
/replace="t"
/db_xref="dbSNP:182126192"
variation 333
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:373494215"
variation 367
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:376036036"
variation 376
/gene="CENPH"
/replace="c"
/replace="g"
/db_xref="dbSNP:376726420"
variation 387
/gene="CENPH"
/replace="g"
/replace="t"
/db_xref="dbSNP:201323177"
exon 402..458
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 432
/gene="CENPH"
/replace="a"
/replace="c"
/db_xref="dbSNP:371312678"
exon 459..522
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 511
/gene="CENPH"
/replace="a"
/replace="c"
/db_xref="dbSNP:199802169"
exon 523..574
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 563
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:116129735"
variation 568
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:113534604"
exon 575..738
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 612
/gene="CENPH"
/replace="a"
/replace="c"
/db_xref="dbSNP:147701359"
variation 632
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:142524123"
variation 649
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:114301971"
variation 683
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:150256446"
variation 712
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:138892809"
exon 739..1389
/gene="CENPH"
/inference="alignment:Splign:1.39.8"
variation 764
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:200621400"
variation 769
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:372296878"
variation 817
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:375648256"
variation 903..906
/gene="CENPH"
/replace=""
/replace="tgtc"
/db_xref="dbSNP:374838407"
variation 914
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:372930981"
variation 941
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:367681440"
variation 1034..1036
/gene="CENPH"
/replace=""
/replace="ttg"
/db_xref="dbSNP:368362241"
variation 1059
/gene="CENPH"
/replace="a"
/replace="c"
/db_xref="dbSNP:60113639"
variation 1071
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:189415911"
variation 1127
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:61743885"
variation 1153
/gene="CENPH"
/replace="c"
/replace="t"
/db_xref="dbSNP:112703036"
variation 1245
/gene="CENPH"
/replace="c"
/replace="g"
/db_xref="dbSNP:111243827"
variation 1275
/gene="CENPH"
/replace="a"
/replace="g"
/db_xref="dbSNP:75832464"
polyA_signal 1370..1375
/gene="CENPH"
polyA_site 1389
/gene="CENPH"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
tttcccggcgtccatttagtggcgggaaaagcgaccttttctgagcgcgtttgcctgttgagtggtagcctttcccctcaaccagcaatggaggagcagccccagatgcaagacgccgacgagcccgcggactccggaggggaaggccgggcaggcgggccaccgcaggtcgccggcgcccaggcggcgtgcagcgaggaccgcatgaccctgctcctcaggctgagagcacagacaaaacaacaactcttagaatataaatcaatggttgatgcaagtgaagaaaaaactccagaacaaattatgcaagaaaagcaaatcgaagctaaaattgaagacctggaaaatgaaattgaagaggtaaaagttgcttttgagataaaaaagcttgcattagacaggatgagactttcaactgcacttaaaaaaaacctggagaaaattagcagacagtctagtgtgctcatggataacatgaaacacctattagagctaaataaattaataatgaaatcacagcaggaatcttgggatttagaggaaaaactgcttgatattagaaagaagagattgcaattaaaacaagcttcagaaagtaagcttttagaaatacagactgaaaagaacaaacagaagattgatttggacagtatggaaaactcagagaggataaagatcatacgacaaaacctacagatggagataaaaattactactgttattcaacatgtgttccagaaccttattttggggagtaaagtcaattgggcagaggatcctgcccttaaggaaattgttctgcagcttgagaagaatgttgacatgatgtaataagaattcatttctgacatattttacatttctggcaatctcaactcttatttggaatacttctgtgcatttgtctgtccaccgtaattttagaaaagcatatccataacgtttacagttgtagtacagttgtggttagttatttgtagtgggattgaaagtaatttttttctttttatatttctatatttagtttgtttttttgttgttgttgttttttgagatggagtctcgctttgttgcccagactggagggcagtggcgcgatctcggctcactgcaacctctgcctcccgggttcaagcagttctgcctcagcctcccaagtagctgtgactaaaggtgcacgccgccatgcccagctaattttttgtattttagtagagacggggtttcaccgtgttgcccaggctgctctcagaactcctgagctcaggcagtccaccgcctcggcctaccgaagtgctaggattacagacgtaagccaccgagcctggtctagtttgcattttttttctatcagttttataagttaagaaataaaaggaattaatgttaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:64946 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:64946 -> Molecular function: GO:0043515 [kinetochore binding] evidence: IDA
GeneID:64946 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:64946 -> Biological process: GO:0006334 [nucleosome assembly] evidence: TAS
GeneID:64946 -> Biological process: GO:0007059 [chromosome segregation] evidence: IEA
GeneID:64946 -> Biological process: GO:0034080 [CENP-A containing nucleosome assembly at centromere] evidence: TAS
GeneID:64946 -> Biological process: GO:0051301 [cell division] evidence: IEA
GeneID:64946 -> Biological process: GO:0051383 [kinetochore organization] evidence: TAS
GeneID:64946 -> Cellular component: GO:0000776 [kinetochore] evidence: IDA
GeneID:64946 -> Cellular component: GO:0000776 [kinetochore] evidence: IMP
GeneID:64946 -> Cellular component: GO:0000776 [kinetochore] evidence: NAS
GeneID:64946 -> Cellular component: GO:0000777 [condensed chromosome kinetochore] evidence: IEA
GeneID:64946 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:64946 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:64946 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.