2024-04-25 20:41:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_022112 1278 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens tumor protein p53 regulated apoptosis inducing protein 1 (TP53AIP1), transcript variant 1, mRNA. ACCESSION NM_022112 VERSION NM_022112.2 GI:304434533 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1278) AUTHORS Luykx,J.J., Bakker,S.C., Lentjes,E., Neeleman,M., Strengman,E., Mentink,L., Deyoung,J., de Jong,S., Sul,J.H., Eskin,E., van Eijk,K., van Setten,J., Buizer-Voskamp,J.E., Cantor,R.M., Lu,A., van Amerongen,M., van Dongen,E.P., Keijzers,P., Kappen,T., Borgdorff,P., Bruins,P., Derks,E.M., Kahn,R.S. and Ophoff,R.A. TITLE Genome-wide association study of monoamine metabolite levels in human cerebrospinal fluid JOURNAL Mol. Psychiatry (2013) In press PUBMED 23319000 REMARK Publication Status: Available-Online prior to print REFERENCE 2 (bases 1 to 1278) AUTHORS Yuan,L., Tian,C., Wang,H., Song,S., Li,D., Xing,G., Yin,Y., He,F. and Zhang,L. TITLE Apak competes with p53 for direct binding to intron 1 of p53AIP1 to regulate apoptosis JOURNAL EMBO Rep. 13 (4), 363-370 (2012) PUBMED 22334068 REMARK GeneRIF: Apak competes with p53 for binding to inhibit p53AIP1 expression. REFERENCE 3 (bases 1 to 1278) AUTHORS Luedeke,M., Coinac,I., Linnert,C.M., Bogdanova,N., Rinckleb,A.E., Schrader,M., Vogel,W., Hoegel,J., Meyer,A., Dork,T. and Maier,C. TITLE Prostate cancer risk is not altered by TP53AIP1 germline mutations in a German case-control series JOURNAL PLoS ONE 7 (3), E34128 (2012) PUBMED 22457820 REMARK GeneRIF: large sample size of the combined cohort rejects a high-risk effect greater than 2.2 and indicates a limited role of TP53AIP1 in prostate cancer predisposition REFERENCE 4 (bases 1 to 1278) AUTHORS Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H., Schreiber,S. and Nebel,A. TITLE Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study JOURNAL Mutat. Res. 694 (1-2), 13-19 (2010) PUBMED 20800603 REMARK GeneRIF: Observational study of gene-disease association. (HuGE Navigator) REFERENCE 5 (bases 1 to 1278) AUTHORS Yamashita,S., Chujo,M., Miyawaki,M., Tokuishi,K., Anami,K., Yamamoto,S. and Kawahara,K. TITLE Combination of p53AIP1 and survivin expression is a powerful prognostic marker in non-small cell lung cancer JOURNAL J. Exp. Clin. Cancer Res. 28, 22 (2009) PUBMED 19228369 REMARK GeneRIF: Data suggest that the combination of p53AIP1 and survivin gene expression may be a powerful tool to stratify subgroups with better or worse prognosis from the variable non-small cell lung cancer population. Publication Status: Online-Only REFERENCE 6 (bases 1 to 1278) AUTHORS Wesierska-Gadek,J., Gueorguieva,M. and Horky,M. TITLE Roscovitine-induced up-regulation of p53AIP1 protein precedes the onset of apoptosis in human MCF-7 breast cancer cells JOURNAL Mol. Cancer Ther. 4 (1), 113-124 (2005) PUBMED 15657359 REMARK GeneRIF: Roscovitine induced up-regulation of p53AIP1 protein and the depolarization of mitochondrial potential. Erratum:[Mol Cancer Ther. 2005 Mar;4(3):503] REFERENCE 7 (bases 1 to 1278) AUTHORS Chan,K.T. and Lung,M.L. TITLE Mutant p53 expression enhances drug resistance in a hepatocellular carcinoma cell line JOURNAL Cancer Chemother. Pharmacol. 53 (6), 519-526 (2004) PUBMED 15004724 REMARK GeneRIF: expression of the p53 mutant, R248Q, in liver cancer cells may enhance their drug resistance and upregulation of P-glycoprotein activity may contribute to this protective effect. REFERENCE 8 (bases 1 to 1278) AUTHORS Kovesi,G. and Szende,B. TITLE Changes in apoptosis and mitotic index, p53 and Ki67 expression in various types of oral leukoplakia JOURNAL Oncology 65 (4), 331-336 (2003) PUBMED 14707453 REMARK GeneRIF: The expression of Ki67 and p53 in various forms of leukoplakia point to the increasing instability of the genome in parallel with the severity of leukoplakia. REFERENCE 9 (bases 1 to 1278) AUTHORS Matsuda,K., Yoshida,K., Taya,Y., Nakamura,K., Nakamura,Y. and Arakawa,H. TITLE p53AIP1 regulates the mitochondrial apoptotic pathway JOURNAL Cancer Res. 62 (10), 2883-2889 (2002) PUBMED 12019168 REMARK GeneRIF: p53AIP1 regulates the mitochondrial apoptotic pathway. REFERENCE 10 (bases 1 to 1278) AUTHORS Oda,K., Arakawa,H., Tanaka,T., Matsuda,K., Tanikawa,C., Mori,T., Nishimori,H., Tamai,K., Tokino,T., Nakamura,Y. and Taya,Y. TITLE p53AIP1, a potential mediator of p53-dependent apoptosis, and its regulation by Ser-46-phosphorylated p53 JOURNAL Cell 102 (6), 849-862 (2000) PUBMED 11030628 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL703609.1, DB111427.1 and AB045830.1. On Aug 25, 2010 this sequence version replaced gi:11545826. Summary: This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]. Transcript Variant: This variant (1, also known as alpha) represents the longest transcript and encodes the longest isoform (a). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AB045830.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025085, ERS025086 [ECO:0000350] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-263 AL703609.1 1-263 264-472 DB111427.1 8-216 473-1278 AB045830.1 1-806 FEATURES Location/Qualifiers source 1..1278 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="11" /map="11q24" gene 1..1278 /gene="TP53AIP1" /gene_synonym="P53AIP1" /note="tumor protein p53 regulated apoptosis inducing protein 1" /db_xref="GeneID:63970" /db_xref="HGNC:29984" /db_xref="MIM:605426" exon 1..606 /gene="TP53AIP1" /gene_synonym="P53AIP1" /inference="alignment:Splign:1.39.8" exon 607..823 /gene="TP53AIP1" /gene_synonym="P53AIP1" /inference="alignment:Splign:1.39.8" misc_feature 635..637 /gene="TP53AIP1" /gene_synonym="P53AIP1" /note="upstream in-frame stop codon" CDS 683..1057 /gene="TP53AIP1" /gene_synonym="P53AIP1" /note="isoform a is encoded by transcript variant 1" /codon_start=1 /product="p53-regulated apoptosis-inducing protein 1 isoform a" /protein_id="NP_071395.2" /db_xref="GI:304434534" /db_xref="CCDS:CCDS8480.2" /db_xref="GeneID:63970" /db_xref="HGNC:29984" /db_xref="MIM:605426" /translation="
MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSVSSGSWSSATVWILTGLGLGLSRPFLPGATVLRDRPLGSAFELSYDQKKAPLRLQ
" variation 702 /gene="TP53AIP1" /gene_synonym="P53AIP1" /replace="c" /replace="t" /db_xref="dbSNP:35942033" exon 824..935 /gene="TP53AIP1" /gene_synonym="P53AIP1" /inference="alignment:Splign:1.39.8" exon 936..1278 /gene="TP53AIP1" /gene_synonym="P53AIP1" /inference="alignment:Splign:1.39.8" polyA_signal 1260..1265 /gene="TP53AIP1" /gene_synonym="P53AIP1" polyA_site 1278 /gene="TP53AIP1" /gene_synonym="P53AIP1" ORIGIN
gtgggaagttggaaaaaataatctgcaaggtaaacaccttcaagtcaatttcaagaggctggctagaaaccgccaggacttcagggggccctgtctcgcgggtctccctgcgccctcagcactttggcttggtataaggccaccttgtccctgaagagaggcctattttaagctgagcaagaaaaggtgagaaagactaaaatcagctttgtgcagagacgccaatttctgctgcacacatggaaacgatgtgcacatacagcgagctggcccagctcccggccacgtggctcacactgtccgtgctcacccacccgttgccttcacccccagcagcactggttgtgaaaagggtaactgcctgagccaccccaccactgcgggcctgccaaggacaggcaggaactcagccatgccccgcaaggagcccaggggcatctccagggacggctccccagcctatgggctcgctccctgagaggccgtgctcgggctcgcctgctcagctcactccgaaagcctctgctcagacctgcacccagtcacagcagcacagatgtgcaggaggagaccatttccacggaccctccgactcctaggaggcagtcccttagggactggccctaacaacaaatgaggagaagccaagttctctgctttctgcagacagggcctcccctggatgggatcttcctctgaggcgagcttcagatctgctcaagcttcctgcagtggggccaggaggcagggcctgggcaggggagaccagaacctctcggtgatgcctccgaatggcagggctcagacacacacacctggctgggtttcagatcccttagttttgggtgcccaagttcacggagggtgccggggaatagaagctctgtcagtctcgtctggatcttggtcctcagcaactgtctggatcctgacaggccttggtctaggtctctccaggcctttccttcctggagccacagtgcttagagacaggccactggggtcagcatttgagctcagctatgatcagaaaaaagcaccgttgaggttgcagtgagccgagatcacgccactgcactccagcctgggcgacagagagagactccatctcaaaacaaaaacaaacaaacaaacagaaagcaccgtcgagaaatggctccagcgctgactagcggccacctcatttccccccttgaccactgggccagttgggtggctaggttgcctcattttgcatccttctgtatccccaaatctgaaataaaagctggaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:63970 -> Molecular function: GO:0003674 [molecular_function] evidence: ND GeneID:63970 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:63970 -> Cellular component: GO:0005739 [mitochondrion] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.