2024-04-25 10:13:16, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_021797 1414 bp mRNA linear PRI 01-JUL-2013 DEFINITION Homo sapiens chitinase, acidic (CHIA), transcript variant 2, mRNA. ACCESSION NM_021797 VERSION NM_021797.3 GI:384367978 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1414) AUTHORS Di Rosa,M., De Gregorio,C., Malaguarnera,G., Tuttobene,M., Biazzo,F. and Malaguarnera,L. TITLE Evaluation of AMCase and CHIT-1 expression in monocyte macrophages lineage JOURNAL Mol. Cell. Biochem. 374 (1-2), 73-80 (2013) PUBMED 23129258 REMARK GeneRIF: results showed that the expression of AMCase and CHIT-1 were differently modulated in monocyte macrophages at different stage of maturation. The behavior of these two active chitinase suggests that in the immune response their role is complementary. REFERENCE 2 (bases 1 to 1414) AUTHORS Aminuddin,F., Akhabir,L., Stefanowicz,D., Pare,P.D., Connett,J.E., Anthonisen,N.R., Fahy,J.V., Seibold,M.A., Burchard,E.G., Eng,C., Gulsvik,A., Bakke,P., Cho,M.H., Litonjua,A., Lomas,D.A., Anderson,W.H., Beaty,T.H., Crapo,J.D., Silverman,E.K. and Sandford,A.J. TITLE Genetic association between human chitinases and lung function in COPD JOURNAL Hum. Genet. 131 (7), 1105-1114 (2012) PUBMED 22200767 REMARK GeneRIF: study demonstrated genetic associations between chitinase gene variants and lung function level and rate of decline in chronic obstructive pulmonary disease patients from the Lung Health Study; also functional effect of the rs3818822 polymorphism on AMCase levels and activity was demonstrated REFERENCE 3 (bases 1 to 1414) AUTHORS Birben,E., Sackesen,C., Kazani,S., Tincer,G., Karaaslan,C., Durgunsu,B., Gursel,I., Wechsler,M.E., Israel,E. and Kalayci,O. TITLE The effects of an insertion in the 5'UTR of the AMCase on gene expression and pulmonary functions JOURNAL Respir Med 105 (8), 1160-1169 (2011) PUBMED 21511453 REMARK GeneRIF: A ten base pair insertion in the second exon in the 5'UTR region of the AMCase gene may modify the gene expression and thus may affect the severity of asthma. REFERENCE 4 (bases 1 to 1414) AUTHORS Gu,Z., Cao,Z. and Jin,M. TITLE Expression and role of acidic mammalian chitinase and eotaxin-3 in chronic rhinosinusitis with nasal polyps JOURNAL J Otolaryngol Head Neck Surg 40 (1), 64-69 (2011) PUBMED 21303604 REMARK GeneRIF: AMCase and eotaxin-3 may be important mediators in the pathogenesis of nasal polyps. The increased AMCase and eotaxin-3 might lead to nasal polyp formation and growth. REFERENCE 5 (bases 1 to 1414) AUTHORS Park,S.K., Heo,K.W., Hur,D.Y. and Yang,Y.I. TITLE Chitinolytic activity in nasal polyps JOURNAL Am J Rhinol Allergy 25 (1), 12-14 (2011) PUBMED 21711963 REMARK GeneRIF: increased chitinolytic activity in nasal polyps REFERENCE 6 (bases 1 to 1414) AUTHORS Chou,Y.T., Yao,S., Czerwinski,R., Fleming,M., Krykbaev,R., Xuan,D., Zhou,H., Brooks,J., Fitz,L., Strand,J., Presman,E., Lin,L., Aulabaugh,A. and Huang,X. TITLE Kinetic characterization of recombinant human acidic mammalian chitinase JOURNAL Biochemistry 45 (14), 4444-4454 (2006) PUBMED 16584180 REMARK GeneRIF: human AMCase has only one pH optimum for k(cat)/K(m) between pH 4 and 5. Steady state kinetics shows that human AMCase has 'low' intrinsic transglycosidase activity, which leads to the observation of apparent substrate inhibition. REFERENCE 7 (bases 1 to 1414) AUTHORS Zhu,Z., Zheng,T., Homer,R.J., Kim,Y.K., Chen,N.Y., Cohn,L., Hamid,Q. and Elias,J.A. TITLE Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13 pathway activation JOURNAL Science 304 (5677), 1678-1682 (2004) PUBMED 15192232 REMARK GeneRIF: expressed in exaggerated quantities in human asthma REFERENCE 8 (bases 1 to 1414) AUTHORS Goto,M., Fujimoto,W., Nio,J., Iwanaga,T. and Kawasaki,T. TITLE Immunohistochemical demonstration of acidic mammalian chitinase in the mouse salivary gland and gastric mucosa JOURNAL Arch. Oral Biol. 48 (10), 701-707 (2003) PUBMED 12971947 REFERENCE 9 (bases 1 to 1414) AUTHORS Boot,R.G., Blommaart,E.F., Swart,E., Ghauharali-van der Vlugt,K., Bijl,N., Moe,C., Place,A. and Aerts,J.M. TITLE Identification of a novel acidic mammalian chitinase distinct from chitotriosidase JOURNAL J. Biol. Chem. 276 (9), 6770-6778 (2001) PUBMED 11085997 REFERENCE 10 (bases 1 to 1414) AUTHORS Saito,A., Ozaki,K., Fujiwara,T., Nakamura,Y. and Tanigami,A. TITLE Isolation and mapping of a human lung-specific gene, TSA1902, encoding a novel chitinase family member JOURNAL Gene 239 (2), 325-331 (1999) PUBMED 10548734 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AK290702.1, AB025008.1 and BC036339.1. On Apr 14, 2012 this sequence version replaced gi:42542397. Summary: The protein encoded by this gene degrades chitin, which is found in the cell wall of most fungi as well as in arthropods and some nematodes. The encoded protein can also stimulate interleukin 13 expression, and variations in this gene can lead to asthma susceptibility. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]. Transcript Variant: This variant (2) lacks exons in the 5' coding region and initiates translation at a downstream AUG compared to variant 4. The encoded isoform (a, also known as TSA1902-L) has a shorter N-terminus and lacks a signal peptide compared to isoform c. Variants 2, 5, and 7 all encode the same isoform (a). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AB025008.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 AK290702.1 1-10 11-145 AB025008.1 1-135 146-1414 BC036339.1 84-1352 FEATURES Location/Qualifiers source 1..1414 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1p13.2" gene 1..1414 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="chitinase, acidic" /db_xref="GeneID:27159" /db_xref="HGNC:17432" /db_xref="MIM:606080" exon 1..99 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 16..18 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="ct" /db_xref="dbSNP:34698010" variation 16..17 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="ct" /db_xref="dbSNP:374234404" variation 22 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:116488064" variation 44 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:12026825" variation 72 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:149411814" variation 75 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:146385552" variation 88 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:139768111" STS 95..1351 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /db_xref="UniSTS:486602" variation 97 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:142723581" exon 100..156 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 103 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:368828123" variation 110 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:143910053" variation 139 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:147282128" variation 146 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:3818822" variation 156 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:201556508" exon 157..322 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" CDS 167..1273 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /EC_number="3.2.1.14" /note="isoform a is encoded by transcript variant 2; acidic mammalian chitinase; lung-specific protein TSA1902" /codon_start=1 /product="acidic mammalian chitinase isoform a" /protein_id="NP_068569.2" /db_xref="GI:42542398" /db_xref="CCDS:CCDS832.1" /db_xref="GeneID:27159" /db_xref="HGNC:17432" /db_xref="MIM:606080" /translation="
MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
" misc_feature <167..1003 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have...; Region: GH18_chitinase-like; cl10447" /db_xref="CDD:209141" misc_feature <167..937 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="Glyco_18 domain; Region: Glyco_18; smart00636" /db_xref="CDD:197811" misc_feature order(248..250,254..256,260..262,476..481,641..643, 920..922) /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="active site" /db_xref="CDD:119349" misc_feature 1127..1270 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /note="Chitin-binding domain type 2; Region: ChtBD2; smart00494" /db_xref="CDD:197759" variation 189 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:146209261" variation 193 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:150698600" variation 210 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:377228357" variation 216 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:61756687" variation 220 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:41282498" variation 221 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:369223512" variation 225 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:140031055" variation 229 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:200273853" variation 241 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:140252614" variation 260 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="g" /db_xref="dbSNP:144029730" variation 275 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:188294966" variation 279 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:142253415" variation 285 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:373203725" variation 316 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:146460083" variation 318 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:199990081" exon 323..447 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 329 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:139158262" variation 344 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:199860140" variation 347 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:143586120" variation 357 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:144679403" variation 359 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="t" /db_xref="dbSNP:116430435" variation 364 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:200617710" variation 384 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:377181497" variation 407 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:369860168" variation 422 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:199874052" variation 437 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="c" /db_xref="dbSNP:150563512" exon 448..571 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 454 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:140904700" variation 466 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:368843945" variation 478 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:148384495" variation 479 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:200134913" variation 535 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:369614927" variation 537 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:376497990" variation 542 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:147103194" variation 547 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:143960572" variation 556 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:139759326" variation 557 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:142137716" variation 563 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:151297358" exon 572..757 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 595 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:114510939" variation 599 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="t" /db_xref="dbSNP:181434663" variation 626 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:367730751" variation 653 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:78293817" variation 658 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:139093708" variation 667 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /replace="t" /db_xref="dbSNP:143107428" variation 669 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:371506503" variation 674 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:143732960" variation 690 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:150309903" variation 705 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:61748620" variation 715 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:61748619" variation 725 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:79500525" variation 731 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:139420194" variation 733 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:201390788" variation 744 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:150840174" variation 755 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:201266629" exon 758..877 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 765 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:142736771" variation 792 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:139812869" variation 798..799 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="tgcccctcaggaag" /db_xref="dbSNP:151326722" variation 800 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:200566957" variation 802..803 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="cctcaggaagtgcc" /db_xref="dbSNP:375881947" variation 816 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="" /replace="cctcaggaagtgcc" /db_xref="dbSNP:74706064" variation 835 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:144546962" variation 836 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:375947945" variation 838 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:17027410" variation 839 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:190772785" variation 841 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:144182515" variation 850 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:370020615" variation 856 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:182916944" variation 857 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:2275253" variation 864 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:189146821" variation 868 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:200092579" variation 872 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:374270214" exon 878..1019 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 903 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:2275254" variation 910 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:151038298" variation 911 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:201691527" variation 912 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:374315938" variation 914 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:142800191" variation 924 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:373985805" variation 939 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:141843885" variation 955 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:76395847" variation 971 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:36011905" variation 985 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:368203516" variation 993 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:143969273" variation 998 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:147768976" variation 1003 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:2820092" variation 1004 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:371701062" variation 1007 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:12094378" exon 1020..1373 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /inference="alignment:Splign:1.39.8" variation 1027 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:372590829" variation 1034 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:140459744" variation 1048 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:199879175" variation 1057 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:377085074" variation 1060 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:150421495" variation 1062 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:145023911" variation 1063 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="t" /db_xref="dbSNP:187769579" variation 1074 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:144623576" variation 1082 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:199811046" variation 1083 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:141747675" variation 1088 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:138227985" variation 1108 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:376164222" variation 1114 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:35242709" variation 1118 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:149869566" variation 1137 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:2256721" variation 1150 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:369442393" variation 1157 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="c" /db_xref="dbSNP:368010768" variation 1158 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:143551303" variation 1160 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:138073907" variation 1179 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:201456008" variation 1183 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:368211379" variation 1219 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="g" /db_xref="dbSNP:145057685" variation 1228 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:140461957" variation 1229 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:142653250" variation 1268 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:146040153" variation 1290 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="a" /replace="g" /db_xref="dbSNP:373720681" variation 1295 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:139802202" variation 1307 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="c" /replace="t" /db_xref="dbSNP:372826781" variation 1312 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" /replace="g" /replace="t" /db_xref="dbSNP:141163072" polyA_signal 1349..1354 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" polyA_site 1373 /gene="CHIA" /gene_synonym="AMCASE; CHIT2; TSA1902" ORIGIN
aaagcttcatgaaacctcctcgtctgtgcacgaacaggtggccgactctggagcccaggctgttgctttccagtctggtggtgaatcctccatagtctggaacagccagctgaaaactctcctggccattggaggctggaacttcgggactgcccctttcactgccatggtttctactcctgagaaccgccagactttcatcacctcagtcatcaaattcctgcgccagtatgagtttgacgggctggactttgactgggagtaccctggctctcgtgggagccctcctcaggacaagcatctcttcactgtcctggtgcaggaaatgcgtgaagcttttgagcaggaggccaagcagatcaacaagcccaggctgatggtcactgctgcagtagctgctggcatctccaatatccagtctggctatgagatcccccaactgtcacagtacctggactacatccatgtcatgacctacgacctccatggctcctgggagggctacactggagagaacagccccctctacaaatacccgactgacaccggcagcaacgcctacctcaatgtggattatgtcatgaactactggaaggacaatggagcaccagctgagaagctcatcgttggattccctacctatggacacaacttcatcctgagcaacccctccaacactggaattggtgcccccacctctggtgctggtcctgctgggccctatgccaaggagtctgggatctgggcttactacgagatctgtaccttcctgaaaaatggagccactcagggatgggatgcccctcaggaagtgccttatgcctatcagggcaatgtgtgggttggctatgacaacatcaagagcttcgatattaaggctcaatggcttaagcacaacaaatttggaggcgccatggtctgggccattgatctggatgacttcactggcactttctgcaaccagggcaagtttcccctaatctccaccctgaagaaggccctcggcctgcagagtgcaagttgcacggctccagctcagcccattgagccaataactgctgctcccagtggcagcgggaacgggagcgggagtagcagctctggaggcagctcgggaggcagtggattctgtgctgtcagagccaacggcctctaccccgtggcaaataacagaaatgccttctggcactgcgtgaatggagtcacgtaccagcagaactgccaggccgggcttgtcttcgacaccagctgtgattgctgcaactgggcataaacctgacctggtctatattccctagagttccagtctcttttgcttaggacatgttgcccctacctaaagtcctgcaataaaatcagcagtcaaaacatgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:27159 -> Molecular function: GO:0003796 [lysozyme activity] evidence: NAS GeneID:27159 -> Molecular function: GO:0004568 [chitinase activity] evidence: IDA GeneID:27159 -> Molecular function: GO:0004568 [chitinase activity] evidence: NAS GeneID:27159 -> Molecular function: GO:0008061 [chitin binding] evidence: TAS GeneID:27159 -> Molecular function: GO:0019900 [kinase binding] evidence: IPI GeneID:27159 -> Molecular function: GO:0030246 [carbohydrate binding] evidence: NAS GeneID:27159 -> Biological process: GO:0000272 [polysaccharide catabolic process] evidence: IEA GeneID:27159 -> Biological process: GO:0001101 [response to acid] evidence: TAS GeneID:27159 -> Biological process: GO:0002532 [production of molecular mediator involved in inflammatory response] evidence: IDA GeneID:27159 -> Biological process: GO:0006030 [chitin metabolic process] evidence: NAS GeneID:27159 -> Biological process: GO:0006032 [chitin catabolic process] evidence: IDA GeneID:27159 -> Biological process: GO:0006032 [chitin catabolic process] evidence: NAS GeneID:27159 -> Biological process: GO:0006037 [cell wall chitin metabolic process] evidence: TAS GeneID:27159 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:27159 -> Biological process: GO:0006955 [immune response] evidence: NAS GeneID:27159 -> Biological process: GO:0007586 [digestion] evidence: NAS GeneID:27159 -> Biological process: GO:0009620 [response to fungus] evidence: TAS GeneID:27159 -> Biological process: GO:0090197 [positive regulation of chemokine secretion] evidence: IDA GeneID:27159 -> Cellular component: GO:0005615 [extracellular space] evidence: IC GeneID:27159 -> Cellular component: GO:0005615 [extracellular space] evidence: IDA GeneID:27159 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS GeneID:27159 -> Cellular component: GO:0005737 [cytoplasm] evidence: NAS ANNOTATIONS from NCBI Entrez Gene (20130726): NP_068569 -> EC 3.2.1.14
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.