GGRNA | NM_021257.3

LOCUS       NM_021257               1885 bp    mRNA    linear   PRI 09-JUN-2013
DEFINITION  Homo sapiens neuroglobin (NGB), mRNA.
ACCESSION   NM_021257 XM_001129381 XM_001132327
VERSION     NM_021257.3  GI:61676205
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1885)
  AUTHORS   Bocahut,A., Derrien,V., Bernad,S., Sebban,P., Sacquin-Mora,S.,
            Guittet,E. and Lescop,E.
  TITLE     Heme orientation modulates histidine dissociation and ligand
            binding kinetics in the hexacoordinated human neuroglobin
  JOURNAL   J. Biol. Inorg. Chem. 18 (1), 111-122 (2013)
   PUBMED   23135388
  REMARK    GeneRIF: functional impact of heme disorder and cysteine oxidation
            state on the properties of the Ngb ligand
REFERENCE   2  (bases 1 to 1885)
  AUTHORS   Watanabe,S., Takahashi,N., Uchida,H. and Wakasugi,K.
  TITLE     Human neuroglobin functions as an oxidative stress-responsive
            sensor for neuroprotection
  JOURNAL   J. Biol. Chem. 287 (36), 30128-30138 (2012)
   PUBMED   22787149
  REMARK    GeneRIF: the oxidative stress-induced structural changes of human
            Ngb are essential for its neuroprotective activity.
REFERENCE   3  (bases 1 to 1885)
  AUTHORS   Qin,H., Guo,Y., Zhang,C., Zhang,L., Li,M. and Guan,P.
  TITLE     The expression of neuroglobin in astrocytoma
  JOURNAL   Brain Tumor Pathol 29 (1), 10-16 (2012)
   PUBMED   22009023
  REMARK    GeneRIF: We found that NGB was present in a rat astrocytoma cell
            line (C6), human astrocytoma cell line (U251), and human
            astrocytoma tissues
REFERENCE   4  (bases 1 to 1885)
  AUTHORS   Jayaraman,T., Tejero,J., Chen,B.B., Blood,A.B., Frizzell,S.,
            Shapiro,C., Tiso,M., Hood,B.L., Wang,X., Zhao,X., Conrads,T.P.,
            Mallampalli,R.K. and Gladwin,M.T.
  TITLE     14-3-3 binding and phosphorylation of neuroglobin during hypoxia
            modulate six-to-five heme pocket coordination and rate of nitrite
            reduction to nitric oxide
  JOURNAL   J. Biol. Chem. 286 (49), 42679-42689 (2011)
   PUBMED   21965683
  REMARK    GeneRIF: 14-3-3 binding and phosphorylation of neuroglobin during
            hypoxia modulate six-to-five heme pocket coordination and rate of
            nitrite reduction to nitric oxide
REFERENCE   5  (bases 1 to 1885)
  AUTHORS   Jin,K., Mao,X., Xie,L. and Greenberg,D.A.
  TITLE     Neuroglobin expression in human arteriovenous malformation and
            intracerebral hemorrhage
  JOURNAL   Acta Neurochir. Suppl. 111, 315-319 (2011)
   PUBMED   21725774
  REMARK    GeneRIF: This study demonistrated that Neuroglobin overexpression
            in brain with arteriovenous malformation and intracerebral
            hemorrhage.
REFERENCE   6  (bases 1 to 1885)
  AUTHORS   Zhu,Y., Sun,Y., Jin,K. and Greenberg,D.A.
  TITLE     Hemin induces neuroglobin expression in neural cells
  JOURNAL   Blood 100 (7), 2494-2498 (2002)
   PUBMED   12239161
  REMARK    GeneRIF: Expression is induced by hemin in neural cells
REFERENCE   7  (bases 1 to 1885)
  AUTHORS   Pesce,A., Nardini,M., Dewilde,S., Ascenzi,P., Burmester,T.,
            Hankeln,T., Moens,L. and Bolognesi,M.
  TITLE     Human neuroglobin: crystals and preliminary X-ray diffraction
            analysis
  JOURNAL   Acta Crystallogr. D Biol. Crystallogr. 58 (PT 10 PT 2), 1848-1850
            (2002)
   PUBMED   12351835
  REMARK    GeneRIF: an examination of the protein's structure by
            crystallization and x-ray diffraction
REFERENCE   8  (bases 1 to 1885)
  AUTHORS   Zhang,C., Wang,C., Deng,M., Li,L., Wang,H., Fan,M., Xu,W., Meng,F.,
            Qian,L. and He,F.
  TITLE     Full-length cDNA cloning of human neuroglobin and tissue expression
            of rat neuroglobin
  JOURNAL   Biochem. Biophys. Res. Commun. 290 (5), 1411-1419 (2002)
   PUBMED   11820779
  REMARK    GeneRIF: Full-length cDNA cloning and genomic organization of NGB
            have been reported.
REFERENCE   9  (bases 1 to 1885)
  AUTHORS   Dewilde,S., Kiger,L., Burmester,T., Hankeln,T., Baudin-Creuza,V.,
            Aerts,T., Marden,M.C., Caubergs,R. and Moens,L.
  TITLE     Biochemical characterization and ligand binding properties of
            neuroglobin, a novel member of the globin family
  JOURNAL   J. Biol. Chem. 276 (42), 38949-38955 (2001)
   PUBMED   11473128
REFERENCE   10 (bases 1 to 1885)
  AUTHORS   Burmester,T., Weich,B., Reinhardt,S. and Hankeln,T.
  TITLE     A vertebrate globin expressed in the brain
  JOURNAL   Nature 407 (6803), 520-523 (2000)
   PUBMED   11029004
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF422797.1 and BC032509.1.
            On or before Sep 25, 2007 this sequence version replaced
            gi:113424669, gi:113424936, gi:21361878.
            
            Summary: This gene encodes an oxygen-binding protein that is
            distantly related to members of the globin gene family. It is
            highly conserved among other vertebrates. It is expressed in the
            central and peripheral nervous system where it may be involved in
            increasing oxygen availability and providing protection under
            hypoxic/ischemic conditions. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF422797.1, AK098350.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025094 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1641              AF422797.1         1-1641
            1642-1885           BC032509.1         1349-1592
FEATURES             Location/Qualifiers
     source          1..1885
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="14"
                     /map="14q24.3"
     gene            1..1885
                     /gene="NGB"
                     /note="neuroglobin"
                     /db_xref="GeneID:58157"
                     /db_xref="HGNC:14077"
                     /db_xref="HPRD:05602"
                     /db_xref="MIM:605304"
     exon            1..464
                     /gene="NGB"
                     /inference="alignment:Splign:1.39.8"
     variation       316
                     /gene="NGB"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:28988618"
     misc_feature    337..339
                     /gene="NGB"
                     /note="upstream in-frame stop codon"
     CDS             376..831
                     /gene="NGB"
                     /codon_start=1
                     /product="neuroglobin"
                     /protein_id="NP_067080.1"
                     /db_xref="GI:10864065"
                     /db_xref="CCDS:CCDS9856.1"
                     /db_xref="GeneID:58157"
                     /db_xref="HGNC:14077"
                     /db_xref="HPRD:05602"
                     /db_xref="MIM:605304"
                     /translation="

MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

"
     misc_feature    376..822
                     /gene="NGB"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9NPG2.1);
                     Region: Globin"
     misc_feature    388..807
                     /gene="NGB"
                     /note="Globins are heme proteins, which bind and transport
                     oxygen. This family summarizes a diverse set of homologous
                     protein domains, including: (1) tetrameric vertebrate
                     hemoglobins, which are the major protein component of
                     erythrocytes and transport oxygen...; Region: globin;
                     cd01040"
                     /db_xref="CDD:29979"
     misc_feature    order(457..459,487..489,496..501,565..567,574..576,
                     658..663,691..693,700..702,793..795)
                     /gene="NGB"
                     /note="heme-binding site [chemical binding]; other site"
                     /db_xref="CDD:29979"
     exon            465..576
                     /gene="NGB"
                     /inference="alignment:Splign:1.39.8"
     STS             514..606
                     /gene="NGB"
                     /standard_name="NGB"
                     /db_xref="UniSTS:511983"
     exon            577..696
                     /gene="NGB"
                     /inference="alignment:Splign:1.39.8"
     exon            697..1876
                     /gene="NGB"
                     /inference="alignment:Splign:1.39.8"
     variation       1087..1088
                     /gene="NGB"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:200856380"
     variation       1087
                     /gene="NGB"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:28909969"
     variation       1441
                     /gene="NGB"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:28909970"
     variation       1587
                     /gene="NGB"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28909971"
     STS             1623..1775
                     /gene="NGB"
                     /standard_name="D14S693E"
                     /db_xref="UniSTS:151573"
     polyA_signal    1857..1862
                     /gene="NGB"
     polyA_site      1876
                     /gene="NGB"
                     /experiment="experimental evidence, no additional details
                     recorded"
ORIGIN

ttcccaggccaccatagcggctggcggagggagcgcgcgccttgctggcctggagggggcgggggccgtggcggctttaaagcgcccagcccaggcgtcgcggggtggggcggctctggcggctgcggggcgcagggcgcagcggccaagcggggtccccggaagcacagctggggtgtctccacctacgactggccgcgcgccttttctctcccgcgccagggaaggagcggctgcggcccccgccgggcggaggcacggggggcgtacgaggggcggaggggaccgcgtcgcggaggagatggcgcggcacgtgcggtgacggcacccgagccctgagggtcccagccccgcgctccgcgtccccgggacagcatggagcgcccggagcccgagctgatccggcagagctggcgggcagtgagccgcagcccgctggagcacggcaccgtcctgtttgccaggctgtttgccctggagcctgacctgctgcccctcttccagtacaactgccgccagttctccagcccagaggactgtctctcctcgcctgagttcctggaccacatcaggaaggtgatgctcgtgattgatgctgcagtgaccaatgtggaagacctgtcctcactggaggagtaccttgccagcctgggcaggaagcaccgggcagtgggtgtgaagctcagctccttctcgacagtgggtgagtctctgctctacatgctggagaagtgtctgggccctgccttcacaccagccacacgggctgcctggagccaactctacggggccgtagtgcaggccatgagtcgaggctgggatggcgagtaagaggcgaccccgcccggcagcccccatccatctgtgtctgtctgttggcctgtatctgttgtagcccaggctccccaagcttccctgcatcttggtccttgtccccttggccacactggagaggtgatggggcagggctgggtctcagtatcctagagtccagctgcagaaggagtggcttttcctccaggaaggggcttctgggtgtcccctcatccccagtagcctctttcttgcgtttctttttaccttttttggcactccctctgaccccgcgatgagtgttttggtggcagaggtgggatgagctggaaaggtatggaggtgggagaggatggggctcttctgtctgtcctgcttcttcaggtgagtgcaggccaaggcgggggtgagatggctgagcttccagcgccttctgtcctgcctgcccagtcccttcactgctttcctgccccaagatggcttgcttttcacaaataaagagaaagagcagctttagccttcttggtggaatcccaggcagtgggagcagaatcagaactgccagggaagggaagggggacctgggtctcaatgggtctcatttgagtctcgcgggctgtgcagatgccctgacagagtcggtttcctttggcggcattccctttccctcattcagcacttctgctgggaactccctgactattccgctgctgcaggaacccagctagctggccaggtggggaggggctggggaccggccaggaaggaggggtgacttcatcccagagagacccgagttcccccagcccttcatcaccaacccgctcctgcaggagtgagtcttacctcccctggccctcctttctggctcagcctgcagcgactgtgaggccacagctcctcagattcactgcccgctgtgtgccagtactcaggcagctggagagaagagaaggcagcagcagaggcccccgccctcaccccagccatctgcacttgtaccatttgctctgtgctgactgtggtcctataaattcatgagaaataaactggttctgtgtgcaaaaaaaaa

//

Annotations: