Home |
Help |
Advanced search
2024-04-26 21:53:40, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_021178 1505 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens cyclin B1 interacting protein 1, E3 ubiquitin protein
ligase (CCNB1IP1), transcript variant 1, mRNA.
ACCESSION NM_021178
VERSION NM_021178.4 GI:388490202
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1505)
AUTHORS Strong,E.R. and Schimenti,J.C.
TITLE Evidence Implicating CCNB1IP1, a RING Domain-Containing Protein
Required for Meiotic Crossing Over in Mice, as an E3 SUMO Ligase
JOURNAL Genes (Basel) 1 (3), 440-451 (2010)
PUBMED 21779533
REFERENCE 2 (bases 1 to 1505)
AUTHORS Gronholm,M., Muranen,T., Toby,G.G., Utermark,T., Hanemann,C.O.,
Golemis,E.A. and Carpen,O.
TITLE A functional association between merlin and HEI10, a cell cycle
regulator
JOURNAL Oncogene 25 (32), 4389-4398 (2006)
PUBMED 16532029
REMARK GeneRIF: The cyclin B-binding protein and cell cycle regulator
HEI10 is identified as a novel merlin-binding partner; interaction
with merlin affects HEI10 protein levels.
REFERENCE 3 (bases 1 to 1505)
AUTHORS Wang,A.G., Yoon,S.Y., Oh,J.H., Jeon,Y.J., Kim,M., Kim,J.M.,
Byun,S.S., Yang,J.O., Kim,J.H., Kim,D.G., Yeom,Y.I., Yoo,H.S.,
Kim,Y.S. and Kim,N.S.
TITLE Identification of intrahepatic cholangiocarcinoma related genes by
comparison with normal liver tissues using expressed sequence tags
JOURNAL Biochem. Biophys. Res. Commun. 345 (3), 1022-1032 (2006)
PUBMED 16712791
REFERENCE 4 (bases 1 to 1505)
AUTHORS Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J.,
Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and
Kim,N.S.
TITLE Transcriptome analysis of human gastric cancer
JOURNAL Mamm. Genome 16 (12), 942-954 (2005)
PUBMED 16341674
REFERENCE 5 (bases 1 to 1505)
AUTHORS Toby,G.G., Gherraby,W., Coleman,T.R. and Golemis,E.A.
TITLE A novel RING finger protein, human enhancer of invasion 10, alters
mitotic progression through regulation of cyclin B levels
JOURNAL Mol. Cell. Biol. 23 (6), 2109-2122 (2003)
PUBMED 12612082
REMARK GeneRIF: HEI10 defines a divergent class of E3 ubiquitin ligase,
functioning in progression through G(2)/M.
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
DB029392.1, AK026233.1, AF216381.1 and AI301662.1.
On May 25, 2012 this sequence version replaced gi:116812639.
Summary: HEI10 is a member of the E3 ubiquitin ligase family and
functions in progression of the cell cycle through G(2)/M.[supplied
by OMIM, Apr 2004].
Transcript Variant: This variant (1) and variants 2 and 4 encode
the same protein.
##Evidence-Data-START##
Transcript exon combination :: AL161994.1, AK226037.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-34 DB029392.1 1-34
35-878 AK026233.1 2-845
879-1323 AF216381.1 390-834
1324-1505 AI301662.1 3-184 c
FEATURES Location/Qualifiers
source 1..1505
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="14"
/map="14q11.2"
gene 1..1505
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/note="cyclin B1 interacting protein 1, E3 ubiquitin
protein ligase"
/db_xref="GeneID:57820"
/db_xref="HGNC:19437"
/db_xref="MIM:608249"
exon 1..59
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/inference="alignment:Splign:1.39.8"
exon 60..259
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/inference="alignment:Splign:1.39.8"
exon 260..337
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/inference="alignment:Splign:1.39.8"
misc_feature 310..312
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/note="upstream in-frame stop codon"
exon 338..452
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/inference="alignment:Splign:1.39.8"
exon 453..786
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/inference="alignment:Splign:1.39.8"
variation 454
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/replace="a"
/replace="c"
/db_xref="dbSNP:1132644"
CDS 490..1323
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/note="human enhancer of invasion 10"
/codon_start=1
/product="E3 ubiquitin-protein ligase CCNB1IP1"
/protein_id="NP_067001.3"
/db_xref="GI:116812640"
/db_xref="CCDS:CCDS9547.1"
/db_xref="GeneID:57820"
/db_xref="HGNC:19437"
/db_xref="MIM:608249"
/translation="
MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI
"
misc_feature 787..>1014
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/note="Outer membrane protein (OmpH-like); Region: OmpH;
pfam03938"
/db_xref="CDD:202818"
misc_feature 1021..1023
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 1258..1260
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[5]
misc_feature 1264..1266
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[5]
exon 787..1120
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/inference="alignment:Splign:1.39.8"
exon 1121..1505
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/inference="alignment:Splign:1.39.8"
STS 1239..1429
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/standard_name="A002Q36"
/db_xref="UniSTS:47979"
STS 1362..1426
/gene="CCNB1IP1"
/gene_synonym="C14orf18; HEI10"
/standard_name="RH36757"
/db_xref="UniSTS:91487"
ORIGIN
acttcccaaggcgacttcctgtctctccactttctttccctctccgttttggtgggctggttgaagatgaaatccactgaggagggaagtccagcaccctgtgtgccagtccagaactggcccatctgtagaccccctgaaaatcatatgggcttggatttggatattctcaacagaaagggttaaaggctgatggtacctaaagcctggtacttgaattttgatcaagataagctgccttaagttctcttcattacacaaatgatcctagataattgatagatcctgtggttcaactggatttctagatagaagctggattcatgtgatgccagaggagtaaaatttcaagagactgaaaccagatctgagtttcgctgttccagtctggacctctttggtgctgtaaatcctggatatactgtagatgagtactgcgtttttcttttatggcctctcttcagcttctggagacctcactatcctattatgtctttgtgtgaagacatgctgctttgtaattatcgaaagtgtcgcatcaaactctctggctatgcatgggtcactgcctgctctcacatcttctgtgatcagcatggcagtggtgagtttagtcgctcaccagctatctgtcctgcctgcaacagtaccctttctggaaagctagatattgtccgcacagaactcagtccatcagaggaatataaagctatggtattggcaggactgcgaccagagatcgtgttggacattagctcccgagcgctggccttctggacatatcaggtacatcaggaacgtctctatcaagaatacaatttcagcaaggctgagggccatctgaaacagatggagaagatatatactcagcaaatacaaagcaaggatgtagaattgacctctatgaaaggggaggttacctccatgaagaaagtactagaagaatacaagaaaaagttcagtgacatctctgagaaacttatggagcgcaatcgtcagtatcaaaagctccaaggcctctatgatagccttaggctacgaaacatcactattgctaaccatgaaggcacccttgaaccatccatgattgcacagtctggtgttcttggcttcccattaggtaacaactccaagtttcctttggataatacacctgttcgaaatcggggcgatggagatggagattttcagttcagaccattttttgcgggttctcccacagcacctgaacccagcaacagcttttttagttttgtctctccaagtcgtgaattagagcagcagcaagtttctagcagggccttcaaagtaaaaagaatttgagccacgcatagtgtcacgcacctgtgatcccagctacttaggaggttgaggctgggaggatcacttgagcccaggagtctgaggctttagtgatctaagatcatgccactgcactccagcctgggcaacagagtgagaccctgtttctaaaaaaaaataaagataatttagctaactttaca
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:57820 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:57820 -> Molecular function: GO:0016874 [ligase activity] evidence: IEA
GeneID:57820 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
GeneID:57820 -> Biological process: GO:0001825 [blastocyst formation] evidence: IEA
GeneID:57820 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:57820 -> Biological process: GO:0007286 [spermatid development] evidence: IEA
GeneID:57820 -> Biological process: GO:0016567 [protein ubiquitination] evidence: IEA
GeneID:57820 -> Biological process: GO:0035265 [organ growth] evidence: IEA
GeneID:57820 -> Biological process: GO:0051026 [chiasma assembly] evidence: IEA
GeneID:57820 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:57820 -> Cellular component: GO:0005694 [chromosome] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.