Home |
Help |
Advanced search
2024-04-19 16:45:17, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_021127 1954 bp mRNA linear PRI 01-JUL-2013
DEFINITION Homo sapiens phorbol-12-myristate-13-acetate-induced protein 1
(PMAIP1), mRNA.
ACCESSION NM_021127
VERSION NM_021127.2 GI:148922873
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1954)
AUTHORS Gutekunst,M., Mueller,T., Weilbacher,A., Dengler,M.A., Bedke,J.,
Kruck,S., Oren,M., Aulitzky,W.E. and van der Kuip,H.
TITLE Cisplatin hypersensitivity of testicular germ cell tumors is
determined by high constitutive Noxa levels mediated by Oct-4
JOURNAL Cancer Res. 73 (5), 1460-1469 (2013)
PUBMED 23302226
REMARK GeneRIF: Noxa is a central determinant of hypersensitivity to
cisplatin
REFERENCE 2 (bases 1 to 1954)
AUTHORS Matsushima-Miyagi,T., Hatano,K., Nomura,M., Li-Wen,L.,
Nishikawa,T., Saga,K., Shimbo,T. and Kaneda,Y.
TITLE TRAIL and Noxa are selectively upregulated in prostate cancer cells
downstream of the RIG-I/MAVS signaling pathway by nonreplicating
Sendai virus particles
JOURNAL Clin. Cancer Res. 18 (22), 6271-6283 (2012)
PUBMED 23014529
REMARK GeneRIF: Oncolytic viruses selectively induced expression of TRAIL
and Noxa in prostate cancer cells, lung cancer cells, and breast
cancer cells downstream of RIG-I and MAVS.
REFERENCE 3 (bases 1 to 1954)
AUTHORS Grande,L., Bretones,G., Rosa-Garrido,M., Garrido-Martin,E.M.,
Hernandez,T., Fraile,S., Botella,L., de Alava,E., Vidal,A., Garcia
del Muro,X., Villanueva,A., Delgado,M.D. and Fernandez-Luna,J.L.
TITLE Transcription factors Sp1 and p73 control the expression of the
proapoptotic protein NOXA in the response of testicular embryonal
carcinoma cells to cisplatin
JOURNAL J. Biol. Chem. 287 (32), 26495-26505 (2012)
PUBMED 22718761
REMARK GeneRIF: detailed analysis of the Noxa promoter revealed that p73
and Sp1-like factors, Sp1 and KLF6, played key roles in the
transcriptional control of this gene
REFERENCE 4 (bases 1 to 1954)
AUTHORS Barbone,D., Cheung,P., Battula,S., Busacca,S., Gray,S.G.,
Longley,D.B., Bueno,R., Sugarbaker,D.J., Fennell,D.A. and
Broaddus,V.C.
TITLE Vorinostat eliminates multicellular resistance of mesothelioma 3D
spheroids via restoration of Noxa expression
JOURNAL PLoS ONE 7 (12), E52753 (2012)
PUBMED 23300762
REMARK GeneRIF: Vorinostat, is able to ablate the multicellular resistance
to bortezomib by its ability to restore expression of a key
pro-apoptotic Bcl-2 family member, Noxa.
REFERENCE 5 (bases 1 to 1954)
AUTHORS Lerner,M., Haneklaus,M., Harada,M. and Grander,D.
TITLE MiR-200c regulates Noxa expression and sensitivity to proteasomal
inhibitors
JOURNAL PLoS ONE 7 (5), E36490 (2012)
PUBMED 22615771
REMARK GeneRIF: show that miR-200c is a novel negative regulator of the
pro-apoptotic Bcl-2 family member Noxa
REFERENCE 6 (bases 1 to 1954)
AUTHORS Seo,Y.W., Shin,J.N., Ko,K.H., Cha,J.H., Park,J.Y., Lee,B.R.,
Yun,C.W., Kim,Y.M., Seol,D.W., Kim,D.W., Yin,X.M. and Kim,T.H.
TITLE The molecular mechanism of Noxa-induced mitochondrial dysfunction
in p53-mediated cell death
JOURNAL J. Biol. Chem. 278 (48), 48292-48299 (2003)
PUBMED 14500711
REMARK GeneRIF: Noxa-induced mitochondrial dysfunction has a role in
p53-mediated cell death
REFERENCE 7 (bases 1 to 1954)
AUTHORS Jansson,A.K., Emterling,A.M., Arbman,G. and Sun,X.F.
TITLE Noxa in colorectal cancer: a study on DNA, mRNA and protein
expression
JOURNAL Oncogene 22 (30), 4675-4678 (2003)
PUBMED 12879012
REMARK GeneRIF: Noxa may not be of importance in the development of
colorectal cancer
REFERENCE 8 (bases 1 to 1954)
AUTHORS Venter,J.C., Adams,M.D., Myers,E.W., Li,P.W., Mural,R.J.,
Sutton,G.G., Smith,H.O., Yandell,M., Evans,C.A., Holt,R.A.,
Gocayne,J.D., Amanatides,P., Ballew,R.M., Huson,D.H., Wortman,J.R.,
Zhang,Q., Kodira,C.D., Zheng,X.H., Chen,L., Skupski,M.,
Subramanian,G., Thomas,P.D., Zhang,J., Gabor Miklos,G.L.,
Nelson,C., Broder,S., Clark,A.G., Nadeau,J., McKusick,V.A.,
Zinder,N., Levine,A.J., Roberts,R.J., Simon,M., Slayman,C.,
Hunkapiller,M., Bolanos,R., Delcher,A., Dew,I., Fasulo,D.,
Flanigan,M., Florea,L., Halpern,A., Hannenhalli,S., Kravitz,S.,
Levy,S., Mobarry,C., Reinert,K., Remington,K., Abu-Threideh,J.,
Beasley,E., Biddick,K., Bonazzi,V., Brandon,R., Cargill,M.,
Chandramouliswaran,I., Charlab,R., Chaturvedi,K., Deng,Z., Di
Francesco,V., Dunn,P., Eilbeck,K., Evangelista,C., Gabrielian,A.E.,
Gan,W., Ge,W., Gong,F., Gu,Z., Guan,P., Heiman,T.J., Higgins,M.E.,
Ji,R.R., Ke,Z., Ketchum,K.A., Lai,Z., Lei,Y., Li,Z., Li,J.,
Liang,Y., Lin,X., Lu,F., Merkulov,G.V., Milshina,N., Moore,H.M.,
Naik,A.K., Narayan,V.A., Neelam,B., Nusskern,D., Rusch,D.B.,
Salzberg,S., Shao,W., Shue,B., Sun,J., Wang,Z., Wang,A., Wang,X.,
Wang,J., Wei,M., Wides,R., Xiao,C., Yan,C., Yao,A., Ye,J., Zhan,M.,
Zhang,W., Zhang,H., Zhao,Q., Zheng,L., Zhong,F., Zhong,W., Zhu,S.,
Zhao,S., Gilbert,D., Baumhueter,S., Spier,G., Carter,C.,
Cravchik,A., Woodage,T., Ali,F., An,H., Awe,A., Baldwin,D.,
Baden,H., Barnstead,M., Barrow,I., Beeson,K., Busam,D., Carver,A.,
Center,A., Cheng,M.L., Curry,L., Danaher,S., Davenport,L.,
Desilets,R., Dietz,S., Dodson,K., Doup,L., Ferriera,S., Garg,N.,
Gluecksmann,A., Hart,B., Haynes,J., Haynes,C., Heiner,C.,
Hladun,S., Hostin,D., Houck,J., Howland,T., Ibegwam,C., Johnson,J.,
Kalush,F., Kline,L., Koduru,S., Love,A., Mann,F., May,D.,
McCawley,S., McIntosh,T., McMullen,I., Moy,M., Moy,L., Murphy,B.,
Nelson,K., Pfannkoch,C., Pratts,E., Puri,V., Qureshi,H.,
Reardon,M., Rodriguez,R., Rogers,Y.H., Romblad,D., Ruhfel,B.,
Scott,R., Sitter,C., Smallwood,M., Stewart,E., Strong,R., Suh,E.,
Thomas,R., Tint,N.N., Tse,S., Vech,C., Wang,G., Wetter,J.,
Williams,S., Williams,M., Windsor,S., Winn-Deen,E., Wolfe,K.,
Zaveri,J., Zaveri,K., Abril,J.F., Guigo,R., Campbell,M.J.,
Sjolander,K.V., Karlak,B., Kejariwal,A., Mi,H., Lazareva,B.,
Hatton,T., Narechania,A., Diemer,K., Muruganujan,A., Guo,N.,
Sato,S., Bafna,V., Istrail,S., Lippert,R., Schwartz,R., Walenz,B.,
Yooseph,S., Allen,D., Basu,A., Baxendale,J., Blick,L., Caminha,M.,
Carnes-Stine,J., Caulk,P., Chiang,Y.H., Coyne,M., Dahlke,C.,
Mays,A., Dombroski,M., Donnelly,M., Ely,D., Esparham,S., Fosler,C.,
Gire,H., Glanowski,S., Glasser,K., Glodek,A., Gorokhov,M.,
Graham,K., Gropman,B., Harris,M., Heil,J., Henderson,S., Hoover,J.,
Jennings,D., Jordan,C., Jordan,J., Kasha,J., Kagan,L., Kraft,C.,
Levitsky,A., Lewis,M., Liu,X., Lopez,J., Ma,D., Majoros,W.,
McDaniel,J., Murphy,S., Newman,M., Nguyen,T., Nguyen,N., Nodell,M.,
Pan,S., Peck,J., Peterson,M., Rowe,W., Sanders,R., Scott,J.,
Simpson,M., Smith,T., Sprague,A., Stockwell,T., Turner,R.,
Venter,E., Wang,M., Wen,M., Wu,D., Wu,M., Xia,A., Zandieh,A. and
Zhu,X.
TITLE The sequence of the human genome
JOURNAL Science 291 (5507), 1304-1351 (2001)
PUBMED 11181995
REMARK Erratum:[Science 2001 Jun 5;292(5523):1838]
REFERENCE 9 (bases 1 to 1954)
AUTHORS Oda,E., Ohki,R., Murasawa,H., Nemoto,J., Shibue,T., Yamashita,T.,
Tokino,T., Taniguchi,T. and Tanaka,N.
TITLE Noxa, a BH3-only member of the Bcl-2 family and candidate mediator
of p53-induced apoptosis
JOURNAL Science 288 (5468), 1053-1058 (2000)
PUBMED 10807576
REFERENCE 10 (bases 1 to 1954)
AUTHORS Hijikata,M., Kato,N., Sato,T., Kagami,Y. and Shimotohno,K.
TITLE Molecular cloning and characterization of a cDNA for a novel
phorbol-12-myristate-13-acetate-responsive gene that is highly
expressed in an adult T-cell leukemia cell line
JOURNAL J. Virol. 64 (10), 4632-4639 (1990)
PUBMED 2398525
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BF667112.1, BC013120.1, BC032663.1 and BM999509.1.
On Jun 19, 2007 this sequence version replaced gi:10863922.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BF667112.1, D90070.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025084 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-77 BF667112.1 2-78
78-699 BC013120.1 1-622
700-1167 BC032663.1 806-1273
1168-1650 BC013120.1 1092-1574
1651-1954 BM999509.1 1-304 c
FEATURES Location/Qualifiers
source 1..1954
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="18"
/map="18q21.32"
gene 1..1954
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/note="phorbol-12-myristate-13-acetate-induced protein 1"
/db_xref="GeneID:5366"
/db_xref="HGNC:9108"
/db_xref="HPRD:12002"
/db_xref="MIM:604959"
exon 1..276
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/inference="alignment:Splign:1.39.8"
variation 16
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="g"
/replace="t"
/db_xref="dbSNP:183794905"
variation 37
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:72970003"
misc_feature 63..65
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/note="upstream in-frame stop codon"
variation 64
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:187553231"
variation 112
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:192421439"
variation 114
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:113353431"
CDS 219..383
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/note="adult T cell leukemia-derived PMA-responsive;
protein Noxa; PMA-induced protein 1;
immediate-early-response protein APR"
/codon_start=1
/product="phorbol-12-myristate-13-acetate-induced protein
1"
/protein_id="NP_066950.1"
/db_xref="GI:10863923"
/db_xref="CCDS:CCDS11975.1"
/db_xref="GeneID:5366"
/db_xref="HGNC:9108"
/db_xref="HPRD:12002"
/db_xref="MIM:604959"
/translation="
MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT
"
misc_feature 303..329
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q13794.1);
Region: BH3"
misc_feature 339..368
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q13794.1);
Region: Required for mitochondrial location"
variation 246
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:369350146"
variation 260
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:61736947"
variation 270
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:367622391"
exon 277..1936
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/inference="alignment:Splign:1.39.8"
variation 282
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:1126436"
variation 288
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:370010327"
variation 290
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:373590556"
variation 300
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="c"
/db_xref="dbSNP:376990196"
variation 334
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="g"
/db_xref="dbSNP:146841427"
variation 341
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="c"
/db_xref="dbSNP:376797909"
variation 342
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:200274771"
variation 384
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:142504944"
variation 386
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="g"
/db_xref="dbSNP:199746594"
variation 406
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:369661307"
STS 409..638
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/standard_name="STS-D90070"
/db_xref="UniSTS:10208"
variation 442
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:200701850"
variation 451
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:186289188"
variation 457
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:111493733"
variation 598
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="c"
/db_xref="dbSNP:71357660"
variation 685
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:7240965"
variation 702
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:191277486"
variation 731
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="g"
/replace="t"
/db_xref="dbSNP:1041978"
variation 740
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1942918"
variation 801
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="g"
/db_xref="dbSNP:77732188"
variation 842
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:181343195"
variation 846
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:149001141"
variation 905
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:118066714"
STS 919..1108
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/standard_name="RH98852"
/db_xref="UniSTS:91100"
variation 926
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:3826598"
variation 937
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:114858354"
variation 1020
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:7240310"
variation 1027
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:143843017"
variation 1181
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:3826599"
variation 1242
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="t"
/db_xref="dbSNP:58665242"
variation 1271
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:57686154"
variation 1274
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:185902213"
variation 1428
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:74255491"
variation 1561..1564
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace=""
/replace="aaat"
/db_xref="dbSNP:112680252"
STS 1571..1759
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/standard_name="STS-D90070"
/db_xref="UniSTS:75122"
variation 1681
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:7227934"
STS 1735..1916
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/standard_name="RH81004"
/db_xref="UniSTS:85553"
variation 1762..1763
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace=""
/replace="c"
/db_xref="dbSNP:34120135"
variation 1765
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:7245349"
variation 1809..1810
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace=""
/replace="t"
/db_xref="dbSNP:11376390"
variation 1810
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="g"
/replace="t"
/db_xref="dbSNP:138203769"
variation 1812..1813
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace=""
/replace="t"
/db_xref="dbSNP:71814350"
variation 1865
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:190664610"
variation 1866
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="g"
/replace="t"
/db_xref="dbSNP:2849431"
variation 1925
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="c"
/replace="t"
/db_xref="dbSNP:7232296"
variation 1927
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="t"
/db_xref="dbSNP:199734220"
variation 1930
/gene="PMAIP1"
/gene_synonym="APR; NOXA"
/replace="a"
/replace="g"
/db_xref="dbSNP:200740224"
ORIGIN
actggacaaaagcgtggtctctggcgcggggatctcagagtttcccgggcactcaccgtgtgtagttggcatctccgcgcgtccggacacccgatcccagcatccctgcctgcaggactgttcgtgttcagctcgcgtcctgcagctgtccgaggtgctccagttggaggctgaggttcccgggctctgtagctgagtgggcggcggcaccggcggagatgcctgggaagaaggcgcgcaagaacgctcaaccgagccccgcgcgggctccagcagagctggaagtcgagtgtgctactcaactcaggagatttggagacaaactgaacttccggcagaaacttctgaatctgatatccaaactcttctgctcaggaacctgactgcatcaaaaacttgcatgaggggactccttcaaaagagttttctcaggaggtgcacgtttcatcaatttgaagaaagactgcattgtaattgagaggaatgtgaaggtgcattcatgggtgcccttggaaacggaagatggaatacatcaaagtgaatttctgttcaagttttcccagattatcattctttgggatgagagaacattataaaaccactttgtttattttaaagcaagaatggaagacccttgaaaataaagaagtaattattgacacatttcttttttacttagagaatcgttctagtgtttttgccgaagattaccgctggcctactgtgaagggagatgacctgtgattagactgggcggctggggagaaacagttcagtgcattgttgttgttgctgtttttggtgttttgcttttcagtgccaactcagcacattgtatatgattcggtttatacatattaccttgttataatgaaaaaactcattctgagaacactgaaatgttatactcagtgttgatttcttcggtcactacacaacgtaaaatcatttgtttcttttgactcaaattgtattgcttctgttcagatgatctttcattcaatgtgttcctgttgggcgttactagaaactatggaaaactggaaaataactttgaaaaaattggataaagtataggagggttacttggggccagtaaatcagtagactgaacattcaatataataaaagaacatggggattttgtataaccagggataataaaaagaaaaaagaagttaatttttaattgatgtttttgaaacttagtagaacaaatattcagaagtaacttgataagatatgaatgtttctaaagaagtttctaaaggttcggaaaatgctccttgtcacattagtgtgcatcctacaaaaagtgatctcttaatgtaaattaagaatattttcataattggaatatacttttcttaaaaaaaaggaacagttagttctcatctagaatgaaagttccatatatgcattggtgaatatatatgtatacacatacttacatacttatatgggtatctgtatagataatttgtattagagtattatatagcttcttagtagggtctcaagtaagtttcattttttttatctgggctatatacagtcctcaaataaataatgtcttgattttatttcagcaggaataattttatttattttgcctatttataattaaagtatttttctttagtttgaaaatgtgtattaaagttacatttttgagttacaagagtcttataactacttgaatttttagttaaaatgtcttaatgtaggttgtagtcactttagatggaaaattacctcacatctgttttcttcagtattacttaagattgtttatttagtggtagagagttttttttttcagcctagaggcagctattttaccatctggtatttatggtctaatttgtatttaaacatatgcacacatataaaagttgatactgtggcagtaaactattaaaagttttcactgttcaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5366 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:5366 -> Biological process: GO:0001836 [release of cytochrome c from mitochondria] evidence: IEA
GeneID:5366 -> Biological process: GO:0006915 [apoptotic process] evidence: IMP
GeneID:5366 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:5366 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA
GeneID:5366 -> Biological process: GO:0006919 [activation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IEA
GeneID:5366 -> Biological process: GO:0006926 [virus-infected cell apoptotic process] evidence: IDA
GeneID:5366 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IEA
GeneID:5366 -> Biological process: GO:0009411 [response to UV] evidence: IEA
GeneID:5366 -> Biological process: GO:0010165 [response to X-ray] evidence: IEA
GeneID:5366 -> Biological process: GO:0010498 [proteasomal protein catabolic process] evidence: IDA
GeneID:5366 -> Biological process: GO:0010907 [positive regulation of glucose metabolic process] evidence: IDA
GeneID:5366 -> Biological process: GO:0010917 [negative regulation of mitochondrial membrane potential] evidence: ISS
GeneID:5366 -> Biological process: GO:0032461 [positive regulation of protein oligomerization] evidence: IDA
GeneID:5366 -> Biological process: GO:0042149 [cellular response to glucose starvation] evidence: IMP
GeneID:5366 -> Biological process: GO:0043029 [T cell homeostasis] evidence: ISS
GeneID:5366 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IDA
GeneID:5366 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: IMP
GeneID:5366 -> Biological process: GO:0043280 [positive regulation of cysteine-type endopeptidase activity involved in apoptotic process] evidence: IDA
GeneID:5366 -> Biological process: GO:0043331 [response to dsRNA] evidence: IDA
GeneID:5366 -> Biological process: GO:0043517 [positive regulation of DNA damage response, signal transduction by p53 class mediator] evidence: IMP
GeneID:5366 -> Biological process: GO:0043525 [positive regulation of neuron apoptotic process] evidence: IEA
GeneID:5366 -> Biological process: GO:0046902 [regulation of mitochondrial membrane permeability] evidence: IDA
GeneID:5366 -> Biological process: GO:0048147 [negative regulation of fibroblast proliferation] evidence: IEA
GeneID:5366 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: IEP
GeneID:5366 -> Biological process: GO:0072332 [intrinsic apoptotic signaling pathway by p53 class mediator] evidence: IMP
GeneID:5366 -> Biological process: GO:0072593 [reactive oxygen species metabolic process] evidence: IDA
GeneID:5366 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IDA
GeneID:5366 -> Biological process: GO:0090200 [positive regulation of release of cytochrome c from mitochondria] evidence: IMP
GeneID:5366 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: IDA
GeneID:5366 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:5366 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS
GeneID:5366 -> Biological process: GO:1902043 [positive regulation of extrinsic apoptotic signaling pathway via death domain receptors] evidence: IDA
GeneID:5366 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: IDA
GeneID:5366 -> Biological process: GO:2001244 [positive regulation of intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:5366 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:5366 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
GeneID:5366 -> Cellular component: GO:0005741 [mitochondrial outer membrane] evidence: TAS
GeneID:5366 -> Cellular component: GO:0005829 [cytosol] evidence: IDA
GeneID:5366 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.