Home |
Help |
Advanced search
2024-04-25 04:08:55, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_021009 2594 bp mRNA linear PRI 12-MAY-2013
DEFINITION Homo sapiens ubiquitin C (UBC), mRNA.
ACCESSION NM_021009 XM_942709 XM_946288-XM_946327
VERSION NM_021009.5 GI:305632811
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2594)
AUTHORS Nakatani,Y., Kleffmann,T., Linke,K., Condon,S.M., Hinds,M.G. and
Day,C.L.
TITLE Regulation of ubiquitin transfer by XIAP, a dimeric RING E3 ligase
JOURNAL Biochem. J. 450 (3), 629-638 (2013)
PUBMED 23259674
REMARK GeneRIF: Regulation of ubiquitin transfer by XIAP, a dimeric RING
E3 ligase.
REFERENCE 2 (bases 1 to 2594)
AUTHORS Ver Heul,A.M., Fowler,C.A., Ramaswamy,S. and Piper,R.C.
TITLE Ubiquitin regulates caspase recruitment domain-mediated signaling
by nucleotide-binding oligomerization domain-containing proteins
NOD1 and NOD2
JOURNAL J. Biol. Chem. 288 (10), 6890-6902 (2013)
PUBMED 23300079
REMARK GeneRIF: Data suggest that ubiquitin (Ub) binding provides a
negative feedback loop upon NOD1 and NOD2 (nucleotide-binding
oligomerization domain-containing proteins)-dependent activation of
receptor-interacting protein kinase 2 (RIP2).
REFERENCE 3 (bases 1 to 2594)
AUTHORS Vajpai,N., Nisius,L., Wiktor,M. and Grzesiek,S.
TITLE High-pressure NMR reveals close similarity between cold and alcohol
protein denaturation in ubiquitin
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (5), E368-E376 (2013)
PUBMED 23284170
REMARK GeneRIF: Data indicate that pressure induced ubiquitin unfolding in
methanol.
REFERENCE 4 (bases 1 to 2594)
AUTHORS Bianchi,M., Crinelli,R., Giacomini,E., Carloni,E. and Magnani,M.
TITLE A potent enhancer element in the 5'-UTR intron is crucial for
transcriptional regulation of the human ubiquitin C gene
JOURNAL Gene 448 (1), 88-101 (2009)
PUBMED 19733223
REMARK GeneRIF: provide insights into the pivotal role of Sp1/Sp3 binding
to the intronic enhancer in the regulation of UbC transcription.
REFERENCE 5 (bases 1 to 2594)
AUTHORS Board,P.G., Coggan,M., Baker,R.T., Vuust,J. and Webb,G.C.
TITLE Localization of the human UBC polyubiquitin gene to chromosome band
12q24.3
JOURNAL Genomics 12 (4), 639-642 (1992)
PUBMED 1315303
REFERENCE 6 (bases 1 to 2594)
AUTHORS Kanayama,H., Tanaka,K., Aki,M., Kagawa,S., Miyaji,H., Satoh,M.,
Okada,F., Sato,S., Shimbara,N. and Ichihara,A.
TITLE Changes in expressions of proteasome and ubiquitin genes in human
renal cancer cells
JOURNAL Cancer Res. 51 (24), 6677-6685 (1991)
PUBMED 1660345
REFERENCE 7 (bases 1 to 2594)
AUTHORS Baker,R.T. and Board,P.G.
TITLE Unequal crossover generates variation in ubiquitin coding unit
number at the human UbC polyubiquitin locus
JOURNAL Am. J. Hum. Genet. 44 (4), 534-542 (1989)
PUBMED 2564731
REFERENCE 8 (bases 1 to 2594)
AUTHORS Einspanier,R., Sharma,H.S. and Scheit,K.H.
TITLE Cloning and sequence analysis of a cDNA encoding poly-ubiquitin in
human ovarian granulosa cells
JOURNAL Biochem. Biophys. Res. Commun. 147 (2), 581-587 (1987)
PUBMED 2820408
REFERENCE 9 (bases 1 to 2594)
AUTHORS Wiborg,O., Pedersen,M.S., Wind,A., Berglund,L.E., Marcker,K.A. and
Vuust,J.
TITLE The human ubiquitin multigene family: some genes contain multiple
directly repeated ubiquitin coding sequences
JOURNAL EMBO J. 4 (3), 755-759 (1985)
PUBMED 2988935
REFERENCE 10 (bases 1 to 2594)
AUTHORS Schlesinger,D.H. and Goldstein,G.
TITLE Hybrid troponin reconstituted from vertebrate and arthropod
subunits
JOURNAL Nature 255 (5507), 423-424 (1975)
PUBMED 124018
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC395997.1, AC126309.8,
DB077241.1 and AW069329.1.
This sequence is a reference standard in the RefSeqGene project.
On Sep 1, 2010 this sequence version replaced gi:132626734.
Summary: This gene represents a ubiquitin gene, ubiquitin C. The
encoded protein is a polyubiquitin precursor. Conjugation of
ubiquitin monomers or polymers can lead to various effects within a
cell, depending on the residues to which ubiquitin is conjugated.
Ubiquitination has been associated with protein degradation, DNA
repair, cell cycle regulation, kinase modification, endocytosis,
and regulation of other cell signaling pathways. [provided by
RefSeq, Aug 2010].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC039193.1, AB009010.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-48 DC395997.1 1-48
49-49 AC126309.8 107330-107330 c
50-404 DB077241.1 40-394
405-455 AC126309.8 106924-106974 c
456-2566 AC126309.8 104001-106111 c
2567-2594 AW069329.1 7-34 c
FEATURES Location/Qualifiers
source 1..2594
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="12"
/map="12q24.3"
gene 1..2594
/gene="UBC"
/gene_synonym="HMG20"
/note="ubiquitin C"
/db_xref="GeneID:7316"
/db_xref="HGNC:12468"
/db_xref="MIM:191340"
exon 1..455
/gene="UBC"
/gene_synonym="HMG20"
/inference="alignment:Splign:1.39.8"
variation 8
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:28362594"
variation 49
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="g"
/db_xref="dbSNP:2070624"
variation 302
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:2070625"
misc_feature 357..359
/gene="UBC"
/gene_synonym="HMG20"
/note="upstream in-frame stop codon"
variation 421
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:13624"
variation 438
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:8397"
exon 456..2584
/gene="UBC"
/gene_synonym="HMG20"
/inference="alignment:Splign:1.39.8"
CDS 459..2516
/gene="UBC"
/gene_synonym="HMG20"
/codon_start=1
/product="polyubiquitin-C"
/protein_id="NP_066289.2"
/db_xref="GI:67191208"
/db_xref="CCDS:CCDS9260.1"
/db_xref="GeneID:7316"
/db_xref="HGNC:12468"
/db_xref="MIM:191340"
/translation="
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPSDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV
"
misc_feature 459..686
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 459..674
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(474..488,576..578,582..584,588..590,597..605,
660..662,666..686)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(474..476,480..488,573..575,579..584,654..656,
660..662,666..686)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(474..476,480..482,588..590,594..605,660..662,
666..668,672..674,684..686)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 660..662
/gene="UBC"
/gene_synonym="HMG20"
/experiment="experimental evidence, no additional details
recorded"
/note="Essential for function; propagated from
UniProtKB/Swiss-Prot (P0CG48.3); other site"
misc_feature 687..914
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 687..902
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(702..716,804..806,810..812,816..818,825..833,
888..890,894..914)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(702..704,708..716,801..803,807..812,882..884,
888..890,894..914)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(702..704,708..710,816..818,822..833,888..890,
894..896,900..902,912..914)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 915..1142
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 915..1130
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(930..944,1032..1034,1038..1040,1044..1046,
1053..1061,1116..1118,1122..1142)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(930..932,936..944,1029..1031,1035..1040,1110..1112,
1116..1118,1122..1142)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(930..932,936..938,1044..1046,1050..1061,1116..1118,
1122..1124,1128..1130,1140..1142)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 1143..1370
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 1143..1358
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(1158..1172,1260..1262,1266..1268,1272..1274,
1281..1289,1344..1346,1350..1370)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(1158..1160,1164..1172,1257..1259,1263..1268,
1338..1340,1344..1346,1350..1370)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(1158..1160,1164..1166,1272..1274,1278..1289,
1344..1346,1350..1352,1356..1358,1368..1370)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 1371..1598
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 1371..1586
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(1386..1400,1488..1490,1494..1496,1500..1502,
1509..1517,1572..1574,1578..1598)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(1386..1388,1392..1400,1485..1487,1491..1496,
1566..1568,1572..1574,1578..1598)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(1386..1388,1392..1394,1500..1502,1506..1517,
1572..1574,1578..1580,1584..1586,1596..1598)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 1599..1826
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 1599..1814
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(1614..1628,1716..1718,1722..1724,1728..1730,
1737..1745,1800..1802,1806..1826)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(1614..1616,1620..1628,1713..1715,1719..1724,
1794..1796,1800..1802,1806..1826)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(1614..1616,1620..1622,1728..1730,1734..1745,
1800..1802,1806..1808,1812..1814,1824..1826)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 1827..2054
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 1827..2042
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(1842..1856,1944..1946,1950..1952,1956..1958,
1965..1973,2028..2030,2034..2054)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(1842..1844,1848..1856,1941..1943,1947..1952,
2022..2024,2028..2030,2034..2054)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(1842..1844,1848..1850,1956..1958,1962..1973,
2028..2030,2034..2036,2040..2042,2052..2054)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 2055..2282
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 2055..2270
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(2070..2084,2172..2174,2178..2180,2184..2186,
2193..2201,2256..2258,2262..2282)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(2070..2072,2076..2084,2169..2171,2175..2180,
2250..2252,2256..2258,2262..2282)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(2070..2072,2076..2078,2184..2186,2190..2201,
2256..2258,2262..2264,2268..2270,2280..2282)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 2283..2510
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
misc_feature 2283..2498
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:197576"
misc_feature order(2298..2312,2400..2402,2406..2408,2412..2414,
2421..2429,2484..2486,2490..2510)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(2298..2300,2304..2312,2397..2399,2403..2408,
2478..2480,2484..2486,2490..2510)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(2298..2300,2304..2306,2412..2414,2418..2429,
2484..2486,2490..2492,2496..2498,2508..2510)
/gene="UBC"
/gene_synonym="HMG20"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
STS 464..1651
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="AA555564"
/db_xref="UniSTS:206909"
variation 635
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:11537757"
variation 728
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1136639"
variation 737
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1071862"
variation 779
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:1136637"
variation 848
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071758"
STS 915..2521
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="Bda03b10"
/db_xref="UniSTS:41478"
STS 920..1651
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="AA555564"
/db_xref="UniSTS:206909"
STS 984..2581
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="STS-W31616"
/db_xref="UniSTS:51505"
variation 1135
/gene="UBC"
/gene_synonym="HMG20"
/replace="g"
/replace="t"
/db_xref="dbSNP:11537758"
variation 1199
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="g"
/db_xref="dbSNP:1136640"
variation 1208
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1138413"
variation 1217
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071865"
variation 1301
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:11537760"
STS 1371..2521
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="Bda03b10"
/db_xref="UniSTS:41478"
STS 1376..1651
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="AA555564"
/db_xref="UniSTS:206909"
variation 1412
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:8963"
STS 1440..2581
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="STS-W31616"
/db_xref="UniSTS:51505"
variation 1487
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071726"
variation 1514
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:11537764"
variation 1580
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:1136634"
STS 1599..2521
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="Bda03b10"
/db_xref="UniSTS:41478"
STS 1604..1651
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="AA555564"
/db_xref="UniSTS:206909"
STS 1668..2581
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="STS-W31616"
/db_xref="UniSTS:51505"
variation 1715
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:17840844"
STS 1827..2521
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="Bda03b10"
/db_xref="UniSTS:41478"
variation 1895
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071745"
STS 1896..2581
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="STS-W31616"
/db_xref="UniSTS:51505"
variation 2025
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071735"
STS 2055..2521
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="Bda03b10"
/db_xref="UniSTS:41478"
variation 2078
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="g"
/db_xref="dbSNP:1071863"
variation 2084
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1138950"
variation 2099
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071864"
variation 2102
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:1071722"
STS 2124..2581
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="STS-W31616"
/db_xref="UniSTS:51505"
variation 2192
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:11537766"
variation 2198
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:1071756"
variation 2213
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1071757"
variation 2249
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071733"
variation 2252
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071853"
variation 2259
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:3175542"
variation 2273
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:6657"
variation 2288
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:1071727"
variation 2303
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071728"
variation 2327
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:17840837"
variation 2333
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1071799"
variation 2339
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="g"
/db_xref="dbSNP:7959"
variation 2348
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071744"
variation 2351
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071771"
STS 2352..2581
/gene="UBC"
/gene_synonym="HMG20"
/standard_name="STS-W31616"
/db_xref="UniSTS:51505"
variation 2363
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:1071746"
variation 2375
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:112257773"
variation 2414
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:3206619"
variation 2420
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:1071732"
variation 2423
/gene="UBC"
/gene_synonym="HMG20"
/replace="a"
/replace="g"
/db_xref="dbSNP:1071737"
variation 2480
/gene="UBC"
/gene_synonym="HMG20"
/replace="c"
/replace="t"
/db_xref="dbSNP:14565"
polyA_signal 2563..2568
/gene="UBC"
/gene_synonym="HMG20"
polyA_site 2584
/gene="UBC"
/gene_synonym="HMG20"
ORIGIN
aggggccgcggagccgcggctaaggaacgcgggccgcccacccgctcccggtgcagcggcctccgcgccgggttttggcgcctcccgcgggcgcccccctcctcacggcgagcgctgccacgtcagacgaagggcgcagcgagcgtcctgatccttccgcccggacgctcaggacagcggcccgctgctcataagactcggccttagaaccccagtatcagcagaaggacattttaggacgggacttgggtgactctagggcactggttttctttccagagagcggaacaggcgaggaaaagtagtcccttctcggcgattctgcggagggatctccgtggggcggtgaacgccgatgattatataaggacgcgccgggtgtggcacagctagttccgtcgcagccgggatttgggtcgcagttcttgtttgtggatcgctgtgatcgtcacttgacaatgcagatcttcgtgaagactctgactggtaagaccatcaccctcgaggttgagcccagtgacaccatcgagaatgtcaaggcaaagatccaagataaggaaggcatccctcctgaccagcagaggctgatctttgctggaaaacagctggaagatgggcgcaccctgtctgactacaacatccagaaagagtccaccctgcacctggtgctccgtctcagaggtgggatgcaaatcttcgtgaagacactcactggcaagaccatcacccttgaggtcgagcccagtgacaccatcgagaacgtcaaagcaaagatccaggacaaggaaggcattcctcctgaccagcagaggttgatctttgccggaaagcagctggaagatgggcgcaccctgtctgactacaacatccagaaagagtctaccctgcacctggtgctccgtctcagaggtgggatgcagatcttcgtgaagaccctgactggtaagaccatcaccctcgaggtggagcccagtgacaccatcgagaatgtcaaggcaaagatccaagataaggaaggcattccttctgatcagcagaggttgatctttgccggaaaacagctggaagatggtcgtaccctgtctgactacaacatccagaaagagtccaccttgcacctggtactccgtctcagaggtgggatgcaaatcttcgtgaagacactcactggcaagaccatcacccttgaggtcgagcccagtgacactatcgagaacgtcaaagcaaagatccaagacaaggaaggcattcctcctgaccagcagaggttgatctttgccggaaagcagctggaagatgggcgcaccctgtctgactacaacatccagaaagagtctaccctgcacctggtgctccgtctcagaggtgggatgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaagtggagccgagtgacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccagcagaggttgatctttgccggaaaacagctggaagatggtcgtaccctgtctgactacaacatccagaaagagtccaccttgcacctggtgctccgtctcagaggtgggatgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaggtggagccgagtgacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccagcagaggttgatctttgctgggaaacagctggaagatggacgcaccctgtctgactacaacatccagaaagagtccaccctgcacctggtgctccgtcttagaggtgggatgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaagtggagccgagtgacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccagcagaggttgatctttgctgggaaacagctggaagatggacgcaccctgtctgactacaacatccagaaagagtccaccctgcacctggtgctccgtcttagaggtgggatgcagatcttcgtgaagaccctgactggtaagaccatcactctcgaagtggagccgagtgacaccattgagaatgtcaaggcaaagatccaagacaaggaaggcatccctcctgaccagcagaggttgatctttgctgggaaacagctggaagatggacgcaccctgtctgactacaacatccagaaagagtccaccctgcacctggtgctccgtctcagaggtgggatgcaaatcttcgtgaagaccctgactggtaagaccatcaccctcgaggtggagcccagtgacaccatcgagaatgtcaaggcaaagatccaagataaggaaggcatccctcctgatcagcagaggttgatctttgctgggaaacagctggaagatggacgcaccctgtctgactacaacatccagaaagagtccactctgcacttggtcctgcgcttgagggggggtgtctaagtttccccttttaaggtttcaacaaatttcattgcactttcctttcaataaagttgttgcattcccaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7316 -> Molecular function: GO:0002020 [protease binding] evidence: IPI
GeneID:7316 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:7316 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:7316 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:7316 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: TAS
GeneID:7316 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:7316 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:7316 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:7316 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:7316 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0006281 [DNA repair] evidence: TAS
GeneID:7316 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS
GeneID:7316 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS
GeneID:7316 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:7316 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:7316 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0007219 [Notch signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0007220 [Notch receptor processing] evidence: TAS
GeneID:7316 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: TAS
GeneID:7316 -> Biological process: GO:0007254 [JNK cascade] evidence: TAS
GeneID:7316 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:7316 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:7316 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS
GeneID:7316 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:7316 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:7316 -> Biological process: GO:0016197 [endosomal transport] evidence: TAS
GeneID:7316 -> Biological process: GO:0019067 [viral assembly, maturation, egress, and release] evidence: TAS
GeneID:7316 -> Biological process: GO:0019068 [virion assembly] evidence: TAS
GeneID:7316 -> Biological process: GO:0019082 [viral protein processing] evidence: TAS
GeneID:7316 -> Biological process: GO:0019221 [cytokine-mediated signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0030512 [negative regulation of transforming growth factor beta receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:7316 -> Biological process: GO:0032479 [regulation of type I interferon production] evidence: TAS
GeneID:7316 -> Biological process: GO:0032480 [negative regulation of type I interferon production] evidence: TAS
GeneID:7316 -> Biological process: GO:0032481 [positive regulation of type I interferon production] evidence: TAS
GeneID:7316 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0034146 [toll-like receptor 5 signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0034162 [toll-like receptor 9 signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0034166 [toll-like receptor 10 signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0034220 [ion transmembrane transport] evidence: TAS
GeneID:7316 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0035872 [nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0042059 [negative regulation of epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:7316 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:7316 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: TAS
GeneID:7316 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:7316 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: TAS
GeneID:7316 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:7316 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:7316 -> Biological process: GO:0046788 [egress of virus within host cell] evidence: TAS
GeneID:7316 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0050852 [T cell receptor signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: TAS
GeneID:7316 -> Biological process: GO:0051403 [stress-activated MAPK cascade] evidence: TAS
GeneID:7316 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:7316 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:7316 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:7316 -> Biological process: GO:0055085 [transmembrane transport] evidence: TAS
GeneID:7316 -> Biological process: GO:0061418 [regulation of transcription from RNA polymerase II promoter in response to hypoxia] evidence: TAS
GeneID:7316 -> Biological process: GO:0070423 [nucleotide-binding oligomerization domain containing signaling pathway] evidence: TAS
GeneID:7316 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: TAS
GeneID:7316 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS
GeneID:7316 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:7316 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:7316 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:7316 -> Cellular component: GO:0010008 [endosome membrane] evidence: TAS
GeneID:7316 -> Cellular component: GO:0030666 [endocytic vesicle membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.