GGRNA Home | Help | Advanced search

2020-10-24 07:27:59, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_020961               2138 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens methyltransferase like 14 (METTL14), mRNA.
ACCESSION   NM_020961
VERSION     NM_020961.2  GI:34147341
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2138)
  AUTHORS   Kalsi,G., Kuo,P.H., Aliev,F., Alexander,J., McMichael,O.,
            Patterson,D.G., Walsh,D., Zhao,Z., Schuckit,M., Nurnberger,J. Jr.,
            Edenberg,H., Kramer,J., Hesselbrock,V., Tischfield,J.A.,
            Vladimirov,V., Prescott,C.A., Dick,D.M., Kendler,K.S. and
            Riley,B.P.
  TITLE     A systematic gene-based screen of chr4q22-q32 identifies
            association of a novel susceptibility gene, DKK2, with the
            quantitative trait of alcohol dependence symptom counts
  JOURNAL   Hum. Mol. Genet. 19 (12), 2497-2506 (2010)
   PUBMED   20332099
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
            Erratum:[Hum Mol Genet. 2010 Oct 15;19(20):4121. Hesselbrock,
            Victor [added]; Tischfield, Jay A [added]]
REFERENCE   2  (bases 1 to 2138)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC007449.2.
            On Aug 25, 2003 this sequence version replaced gi:24308264.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC006565.2, AB046847.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..2138
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="4"
                     /map="4q26"
     gene            1..2138
                     /gene="METTL14"
                     /note="methyltransferase like 14"
                     /db_xref="GeneID:57721"
                     /db_xref="HGNC:29330"
                     /db_xref="HPRD:13879"
     exon            1..182
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       4
                     /gene="METTL14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:17050450"
     misc_feature    78..80
                     /gene="METTL14"
                     /note="upstream in-frame stop codon"
     CDS             117..1487
                     /gene="METTL14"
                     /codon_start=1
                     /product="methyltransferase-like protein 14"
                     /protein_id="NP_066012.1"
                     /db_xref="GI:24308265"
                     /db_xref="CCDS:CCDS34053.1"
                     /db_xref="GeneID:57721"
                     /db_xref="HGNC:29330"
                     /db_xref="HPRD:13879"
                     /translation="
MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR
"
     misc_feature    714..1205
                     /gene="METTL14"
                     /note="MT-A70; Region: MT-A70; pfam05063"
                     /db_xref="CDD:147310"
     variation       125
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150512311"
     variation       161
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369110196"
     variation       182
                     /gene="METTL14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200778002"
     exon            183..271
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       201
                     /gene="METTL14"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200462174"
     variation       215
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145996004"
     variation       264
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377430180"
     exon            272..359
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       282
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138619764"
     variation       287
                     /gene="METTL14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141704350"
     variation       307
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201299266"
     variation       329
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376007435"
     variation       353
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:62328061"
     exon            360..440
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       403
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376584637"
     exon            441..528
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       467
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140960694"
     variation       500
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112348803"
     exon            529..619
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       613..614
                     /gene="METTL14"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:35492157"
     exon            620..761
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       627
                     /gene="METTL14"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78906144"
     variation       633
                     /gene="METTL14"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:370370248"
     variation       642
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199640936"
     exon            762..854
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       807
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202013242"
     exon            855..971
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     exon            972..1182
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       1012
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202042363"
     variation       1148
                     /gene="METTL14"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:182378552"
     variation       1172
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112726268"
     exon            1183..2120
                     /gene="METTL14"
                     /inference="alignment:Splign:1.39.8"
     variation       1190
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11931194"
     variation       1194
                     /gene="METTL14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148536412"
     variation       1205
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201977372"
     variation       1388
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142851794"
     variation       1394
                     /gene="METTL14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:151041593"
     variation       1410
                     /gene="METTL14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:141195013"
     variation       1450
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369731171"
     variation       1463
                     /gene="METTL14"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:369008787"
     variation       1478
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143516551"
     variation       1522
                     /gene="METTL14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370219944"
     variation       1587
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188561580"
     variation       1657
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114039398"
     variation       1659
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4834698"
     variation       1701
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138412059"
     variation       1704
                     /gene="METTL14"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:190648195"
     variation       1774
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141632546"
     variation       2022
                     /gene="METTL14"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1064034"
     variation       2120
                     /gene="METTL14"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76170672"
ORIGIN      
atactctgttcgtaagctcccggtgaattttgttccacagactcggaagaaaggttggataagagttcactggagattgacaagtactcgggatagtgaaaagccggagttggaacatggatagccgcttgcaggagatccgggagcggcagaagttacggcgacagctcctcgcgcagcagttgggagctgaaagtgccgacagcattggtgccgtgttaaatagcaaagatgagcagagagaaattgctgaaacaagagaaacttgcagggcttcctatgatacctctgctccaaatgcaaaacgtaagtatctggatgaaggagagacagatgaagacaaaatggaagaatataaggatgaactagaaatgcaacaggatgaagaaaatttgccatatgaagaagagatttacaaagattctagtacttttcttaagggaacacagagcttaaatccccataatgattactgccaacattttgtagacactggacatagacctcagaatttcatcagggatgtaggtttagctgacagatttgaagaatatcctaaactgagggagctcatcaggctaaaggatgagttaatagctaaatctaacactcctcccatgtacttacaagccgatatagaagcctttgacatcagagaactaacacccaaatttgatgtgattcttctggaaccccctttagaagaatattacagagaaactggcatcactgctaatgaaaaatgctggacttgggatgatattatgaagttagaaattgatgagattgcagcacctcgatcatttatttttctctggtgtggttctggggaggggttggaccttggaagagtgtgtttacgaaaatggggttacagaagatgtgaagatatttgttggattaaaaccaataaaaacaatcctgggaagactaagactttagatccaaaggctgtctttcagagaacaaaggaacactgcctcatggggatcaaaggaactgtgaagcgtagcacagacggggacttcattcatgctaatgttgacattgacttaattatcacagaagaacctgaaattggcaatatagaaaaacctgtagaaatttttcatataattgagcatttttgtcttggtagaagacgccttcatctatttggaagagatagtacaattcgaccaggctggctcacagttggaccaacgcttacaaatagcaactacaatgcagaaacatatgcatcctatttcagtgctcctaattcctacttgactggttgtacagaagaaattgagagacttcgaccaaaatcgcctcctcccaaatctaaatctgaccgaggaggtggagctcccagaggtggaggaagaggtggaacttctgctggccgtggacgagaaagaaatagatctaacttccgaggagaaagaggtggctttagagggggccgtggaggagcacacagaggtggctttccacctcgataattgttgaagacattgaacctattcatcctcctctaaccttctttattgtaattaaatttcaagtgggagacttaactttagaactcacttccagcttgcactttgctttaatttctctgagctgcaagaatgtcttagcgagccttgcttgcagttgtcacacacactgtccggtttttttcaggataaatgaatgattctgccttttgttatgtgcgtgaacagaatggaacaactcaagtagcttcatcttcagagactgaatttattctgatagacttcagctaattacaaaggattttgctaatttttgggaataaataatggaaaaagatccagtctgtggtatcatgctagtgctgacagggccttgatagaatagagttggaaaagatggtaagcttttgtcagggttttaacattttcttgatgaaacaataaaaagaggtaagcttttttcttctttttttttaagttttaaataaactcagatataatttgaatactgaagaaattaagagactttgaacaaaatctcttcccaaatctaaatttgataggggaggtggagattccaggggtgggtgaaagaagagatagaacttagcaggcagacttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:57721 -> Molecular function: GO:0016422 [mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity] evidence: ISS
            GeneID:57721 -> Biological process: GO:0001510 [RNA methylation] evidence: ISS
            GeneID:57721 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_066012 -> EC 2.1.1.-

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.