Home |
Help |
Advanced search
2024-05-09 04:43:12, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_020530 1869 bp mRNA linear PRI 15-JUN-2013
DEFINITION Homo sapiens oncostatin M (OSM), mRNA.
ACCESSION NM_020530
VERSION NM_020530.4 GI:317008625
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1869)
AUTHORS Jostins,L., Ripke,S., Weersma,R.K., Duerr,R.H., McGovern,D.P.,
Hui,K.Y., Lee,J.C., Schumm,L.P., Sharma,Y., Anderson,C.A.,
Essers,J., Mitrovic,M., Ning,K., Cleynen,I., Theatre,E.,
Spain,S.L., Raychaudhuri,S., Goyette,P., Wei,Z., Abraham,C.,
Achkar,J.P., Ahmad,T., Amininejad,L., Ananthakrishnan,A.N.,
Andersen,V., Andrews,J.M., Baidoo,L., Balschun,T., Bampton,P.A.,
Bitton,A., Boucher,G., Brand,S., Buning,C., Cohain,A., Cichon,S.,
D'Amato,M., De Jong,D., Devaney,K.L., Dubinsky,M., Edwards,C.,
Ellinghaus,D., Ferguson,L.R., Franchimont,D., Fransen,K.,
Gearry,R., Georges,M., Gieger,C., Glas,J., Haritunians,T., Hart,A.,
Hawkey,C., Hedl,M., Hu,X., Karlsen,T.H., Kupcinskas,L.,
Kugathasan,S., Latiano,A., Laukens,D., Lawrance,I.C., Lees,C.W.,
Louis,E., Mahy,G., Mansfield,J., Morgan,A.R., Mowat,C., Newman,W.,
Palmieri,O., Ponsioen,C.Y., Potocnik,U., Prescott,N.J.,
Regueiro,M., Rotter,J.I., Russell,R.K., Sanderson,J.D., Sans,M.,
Satsangi,J., Schreiber,S., Simms,L.A., Sventoraityte,J.,
Targan,S.R., Taylor,K.D., Tremelling,M., Verspaget,H.W., De Vos,M.,
Wijmenga,C., Wilson,D.C., Winkelmann,J., Xavier,R.J., Zeissig,S.,
Zhang,B., Zhang,C.K., Zhao,H., Silverberg,M.S., Annese,V.,
Hakonarson,H., Brant,S.R., Radford-Smith,G., Mathew,C.G.,
Rioux,J.D., Schadt,E.E., Daly,M.J., Franke,A., Parkes,M.,
Vermeire,S., Barrett,J.C. and Cho,J.H.
CONSRTM International IBD Genetics Consortium (IIBDGC)
TITLE Host-microbe interactions have shaped the genetic architecture of
inflammatory bowel disease
JOURNAL Nature 491 (7422), 119-124 (2012)
PUBMED 23128233
REFERENCE 2 (bases 1 to 1869)
AUTHORS David,E., Tirode,F., Baud'huin,M., Guihard,P., Laud,K.,
Delattre,O., Heymann,M.F., Heymann,D., Redini,F. and Blanchard,F.
TITLE Oncostatin M is a growth factor for Ewing sarcoma
JOURNAL Am. J. Pathol. 181 (5), 1782-1795 (2012)
PUBMED 22982441
REMARK GeneRIF: OSM induced proliferation of Ewing sarcoma cell lines.
REFERENCE 3 (bases 1 to 1869)
AUTHORS Ko,H.S., Kang,H.K., Kim,H.S., Choi,S.K., Park,I.Y. and Shin,J.C.
TITLE The effects of oncostatin M on trophoblast cells: influence on
matrix metalloproteinases-2 and -9, and invasion activity
JOURNAL Placenta 33 (11), 908-913 (2012)
PUBMED 22931588
REMARK GeneRIF: Data suggest that OSM enhances invasion activities of
extravillous trophoblasts during placentation through increased
enzyme activity of MMP-2 (primarily) and MMP-9 (to some extent).
REFERENCE 4 (bases 1 to 1869)
AUTHORS Chollangi,S., Mather,T., Rodgers,K.K. and Ash,J.D.
TITLE A unique loop structure in oncostatin M determines binding affinity
toward oncostatin M receptor and leukemia inhibitory factor
receptor
JOURNAL J. Biol. Chem. 287 (39), 32848-32859 (2012)
PUBMED 22829597
REMARK GeneRIF: A unique loop structure in oncostatin M determines binding
affinity toward oncostatin M receptor and leukemia inhibitory
factor receptor.
REFERENCE 5 (bases 1 to 1869)
AUTHORS West,N.R., Murphy,L.C. and Watson,P.H.
TITLE Oncostatin M suppresses oestrogen receptor-alpha expression and is
associated with poor outcome in human breast cancer
JOURNAL Endocr. Relat. Cancer 19 (2), 181-195 (2012)
PUBMED 22267707
REMARK GeneRIF: Oncostatin M signaling may cause suppression of estrogen
receptor-alpha and disease progression i breast cancer.
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1869)
AUTHORS Gearing,D.P., Comeau,M.R., Friend,D.J., Gimpel,S.D., Thut,C.J.,
McGourty,J., Brasher,K.K., King,J.A., Gillis,S., Mosley,B. et al.
TITLE The IL-6 signal transducer, gp130: an oncostatin M receptor and
affinity converter for the LIF receptor
JOURNAL Science 255 (5050), 1434-1437 (1992)
PUBMED 1542794
REFERENCE 7 (bases 1 to 1869)
AUTHORS Miles,S.A., Martinez-Maza,O., Rezai,A., Magpantay,L., Kishimoto,T.,
Nakamura,S., Radka,S.F. and Linsley,P.S.
TITLE Oncostatin M as a potent mitogen for AIDS-Kaposi's sarcoma-derived
cells
JOURNAL Science 255 (5050), 1432-1434 (1992)
PUBMED 1542793
REFERENCE 8 (bases 1 to 1869)
AUTHORS Gearing,D.P. and Bruce,A.G.
TITLE Oncostatin M binds the high-affinity leukemia inhibitory factor
receptor
JOURNAL New Biol. 4 (1), 61-65 (1992)
PUBMED 1536831
REFERENCE 9 (bases 1 to 1869)
AUTHORS Rose,T.M. and Bruce,A.G.
TITLE Oncostatin M is a member of a cytokine family that includes
leukemia-inhibitory factor, granulocyte colony-stimulating factor,
and interleukin 6
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 88 (19), 8641-8645 (1991)
PUBMED 1717982
REFERENCE 10 (bases 1 to 1869)
AUTHORS Kallestad,J.C., Shoyab,M. and Linsley,P.S.
TITLE Disulfide bond assignment and identification of regions required
for functional activity of oncostatin M
JOURNAL J. Biol. Chem. 266 (14), 8940-8945 (1991)
PUBMED 2026606
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BC011589.1.
On Jan 6, 2011 this sequence version replaced gi:28178862.
Summary: Oncostatin M is a member of a cytokine family that
includes leukemia-inhibitory factor, granulocyte colony-stimulating
factor, and interleukin 6. This gene encodes a growth regulator
which inhibits the proliferation of a number of tumor cell lines.
It regulates cytokine production, including IL-6, G-CSF and GM-CSF
from endothelial cells. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC011589.1, BM544068.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025086, ERS025087 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..1869
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="22"
/map="22q12.2"
gene 1..1869
/gene="OSM"
/note="oncostatin M"
/db_xref="GeneID:5008"
/db_xref="HGNC:8506"
/db_xref="HPRD:01300"
/db_xref="MIM:165095"
exon 1..75
/gene="OSM"
/inference="alignment:Splign:1.39.8"
CDS 42..800
/gene="OSM"
/note="oncostatin-M"
/codon_start=1
/product="oncostatin-M preproprotein"
/protein_id="NP_065391.1"
/db_xref="GI:10092621"
/db_xref="CCDS:CCDS13873.1"
/db_xref="GeneID:5008"
/db_xref="HGNC:8506"
/db_xref="HPRD:01300"
/db_xref="MIM:165095"
/translation="
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRKGKRLMTRGQLPR
"
sig_peptide 42..116
/gene="OSM"
proprotein 117..797
/gene="OSM"
/product="oncostatin-M proprotein"
mat_peptide 117..704
/gene="OSM"
/product="oncostatin-M"
misc_feature order(132..134,495..497)
/gene="OSM"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
/citation=[10]
misc_feature 150..668
/gene="OSM"
/note="LIF / OSM family; Region: LIF_OSM; pfam01291"
/db_xref="CDD:201714"
misc_feature order(261..263,615..617)
/gene="OSM"
/experiment="experimental evidence, no additional details
recorded"
/note="disulfide bridge bond"
/citation=[10]
exon 76..218
/gene="OSM"
/inference="alignment:Splign:1.39.8"
exon 219..1854
/gene="OSM"
/inference="alignment:Splign:1.39.8"
STS 365..818
/gene="OSM"
/standard_name="GDB:194718"
/db_xref="UniSTS:155797"
STS 837..1018
/gene="OSM"
/standard_name="STS-M27288"
/db_xref="UniSTS:55412"
variation 1106
/gene="OSM"
/replace="c"
/replace="t"
/db_xref="dbSNP:2070889"
variation 1136
/gene="OSM"
/replace="c"
/replace="t"
/db_xref="dbSNP:2070890"
STS 1253..1460
/gene="OSM"
/standard_name="GDB:452636"
/db_xref="UniSTS:157402"
polyA_site 1854
/gene="OSM"
ORIGIN
gtcacccccagcgggcgcgggccggagcacgggcacccagcatgggggtactgctcacacagaggacgctgctcagtctggtccttgcactcctgtttccaagcatggcgagcatggcggctataggcagctgctcgaaagagtaccgcgtgctccttggccagctccagaagcagacagatctcatgcaggacaccagcagactcctggacccctatatacgtatccaaggcctggatgttcctaaactgagagagcactgcagggagcgccccggggccttccccagtgaggagaccctgagggggctgggcaggcggggcttcctgcagaccctcaatgccacactgggctgcgtcctgcacagactggccgacttagagcagcgcctccccaaggcccaggatttggagaggtctgggctgaacatcgaggacttggagaagctgcagatggcgaggccgaacatcctcgggctcaggaacaacatctactgcatggcccagctgctggacaactcagacacggctgagcccacgaaggctggccggggggcctctcagccgcccacccccacccctgcctcggatgcttttcagcgcaagctggagggctgcaggttcctgcatggctaccatcgcttcatgcactcagtggggcgggtcttcagcaagtggggggagagcccgaaccggagccggagacacagcccccaccaggccctgaggaagggggtgcgcaggaccagaccctccaggaaaggcaagagactcatgaccaggggacagctgccccggtagcctcgagagcaccccttgccggtgaaggatgcggcaggtgctctgtggatgagaggaaccatcgcaggatgacagctcccgggtccccaaacctgttcccctctgctactagccactgagaagtgcactttaagaggtgggagctgggcagacccctctacctcctccaggctgggagacagagtcaggctgttgcgctcccacctcagccccaagttccccaggcccagtggggtggccgggcgggccacgcgggaccgactttccattgattcaggggtctgatgacacaggctgactcatggccgggctgactgcccccctgccttgctccccgaggcctgccggtccttccctctcatgacttgcagggccgttgcccccagacttcctcctttccgtgtttctgaaggggaggtcacagcctgagctggcctcctatgcctcatcatgtcccaaaccagacacctggatgtctgggtgacctcactttaggcagctgtaacagcggcagggtgtcccaggagccctgatccgggggtccagggaatggagctcaggtcccaggccagccccgaagtcgccacgtggcctggggcaggtcactttacctctgtggacctgttttctctttgtgaagctagggagttagaggctgtacaaggcccccactgcctgtcggttgcttggattccctgacgtaaggtggatattaaaaatctgtaaatcaggacaggtggtgcaaatggcgctgggaggtgtacacggaggtctctgtaaaagcagacccacctcccagcgccgggaagcccgtcttgggtcctcgctgctggctgctccccctggtggtggatcctggaattttctcacgcaggagccattgctctcctagagggggtctcagaaactgcgaggccagttccttggagggacatgactaatttatcgatttttatcaatttttatcagttttatatttataagccttatttatgatgtatatttaatgttaatattgtgcaaacttatatttaaaacttgcctggtttctaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:5008 -> Molecular function: GO:0005125 [cytokine activity] evidence: IDA
GeneID:5008 -> Molecular function: GO:0005147 [oncostatin-M receptor binding] evidence: IPI
GeneID:5008 -> Molecular function: GO:0008083 [growth factor activity] evidence: IDA
GeneID:5008 -> Biological process: GO:0002675 [positive regulation of acute inflammatory response] evidence: IC
GeneID:5008 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:5008 -> Biological process: GO:0006955 [immune response] evidence: IEA
GeneID:5008 -> Biological process: GO:0007275 [multicellular organismal development] evidence: TAS
GeneID:5008 -> Biological process: GO:0007422 [peripheral nervous system development] evidence: IEA
GeneID:5008 -> Biological process: GO:0008283 [cell proliferation] evidence: TAS
GeneID:5008 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IDA
GeneID:5008 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: TAS
GeneID:5008 -> Biological process: GO:0009408 [response to heat] evidence: IEA
GeneID:5008 -> Biological process: GO:0033138 [positive regulation of peptidyl-serine phosphorylation] evidence: IDA
GeneID:5008 -> Biological process: GO:0040008 [regulation of growth] evidence: IEA
GeneID:5008 -> Biological process: GO:0042503 [tyrosine phosphorylation of Stat3 protein] evidence: IEA
GeneID:5008 -> Biological process: GO:0042506 [tyrosine phosphorylation of Stat5 protein] evidence: IEA
GeneID:5008 -> Biological process: GO:0042508 [tyrosine phosphorylation of Stat1 protein] evidence: IEA
GeneID:5008 -> Biological process: GO:0043410 [positive regulation of MAPK cascade] evidence: IDA
GeneID:5008 -> Biological process: GO:0045835 [negative regulation of meiosis] evidence: IEA
GeneID:5008 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IDA
GeneID:5008 -> Biological process: GO:0046888 [negative regulation of hormone secretion] evidence: IDA
GeneID:5008 -> Biological process: GO:0048266 [behavioral response to pain] evidence: IEA
GeneID:5008 -> Biological process: GO:0050731 [positive regulation of peptidyl-tyrosine phosphorylation] evidence: IDA
GeneID:5008 -> Biological process: GO:0051781 [positive regulation of cell division] evidence: IEA
GeneID:5008 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
GeneID:5008 -> Cellular component: GO:0005900 [oncostatin-M receptor complex] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.