GGRNA Home | Help | Advanced search

2020-10-24 06:27:45, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_020368               2088 bp    mRNA    linear   PRI 24-MAR-2013
DEFINITION  Homo sapiens UTP3, small subunit (SSU) processome component,
            homolog (S. cerevisiae) (UTP3), mRNA.
ACCESSION   NM_020368
VERSION     NM_020368.2  GI:209977043
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2088)
  AUTHORS   Park,S.K., Son,Y. and Kang,C.J.
  TITLE     A strong promoter activity of pre-B cell stage-specific Crlz1 gene
            is caused by one distal LEF-1 and multiple proximal Ets sites
  JOURNAL   Mol. Cells 32 (1), 67-76 (2011)
   PUBMED   21544627
  REMARK    GeneRIF: A strong promoter activity of pre-B cell stage-specific
            Crlz1 gene is caused by one distal LEF-1 and multiple proximal Ets
            sites.
REFERENCE   2  (bases 1 to 2088)
  AUTHORS   Lim,J.H., Cho,S.J., Park,S.K., Kim,J., Cho,D., Lee,W.J. and
            Kang,C.J.
  TITLE     Stage-specific expression of two neighboring Crlz1 and IgJ genes
            during B cell development is regulated by their chromatin
            accessibility and histone acetylation
  JOURNAL   J. Immunol. 177 (8), 5420-5429 (2006)
   PUBMED   17015728
REFERENCE   3  (bases 1 to 2088)
  AUTHORS   Nousiainen,M., Sillje,H.H., Sauer,G., Nigg,E.A. and Korner,R.
  TITLE     Phosphoproteome analysis of the human mitotic spindle
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396 (2006)
   PUBMED   16565220
REFERENCE   4  (bases 1 to 2088)
  AUTHORS   Stelzl,U., Worm,U., Lalowski,M., Haenig,C., Brembeck,F.H.,
            Goehler,H., Stroedicke,M., Zenkner,M., Schoenherr,A., Koeppen,S.,
            Timm,J., Mintzlaff,S., Abraham,C., Bock,N., Kietzmann,S.,
            Goedde,A., Toksoz,E., Droege,A., Krobitsch,S., Korn,B.,
            Birchmeier,W., Lehrach,H. and Wanker,E.E.
  TITLE     A human protein-protein interaction network: a resource for
            annotating the proteome
  JOURNAL   Cell 122 (6), 957-968 (2005)
   PUBMED   16169070
REFERENCE   5  (bases 1 to 2088)
  AUTHORS   Andersen,J.S., Lam,Y.W., Leung,A.K., Ong,S.E., Lyon,C.E.,
            Lamond,A.I. and Mann,M.
  TITLE     Nucleolar proteome dynamics
  JOURNAL   Nature 433 (7021), 77-83 (2005)
   PUBMED   15635413
REFERENCE   6  (bases 1 to 2088)
  AUTHORS   Andersen,J.S., Lyon,C.E., Fox,A.H., Leung,A.K., Lam,Y.W., Steen,H.,
            Mann,M. and Lamond,A.I.
  TITLE     Directed proteomic analysis of the human nucleolus
  JOURNAL   Curr. Biol. 12 (1), 1-11 (2002)
   PUBMED   11790298
REFERENCE   7  (bases 1 to 2088)
  AUTHORS   Simpson,J.C., Wellenreuther,R., Poustka,A., Pepperkok,R. and
            Wiemann,S.
  TITLE     Systematic subcellular localization of novel proteins identified by
            large-scale cDNA sequencing
  JOURNAL   EMBO Rep. 1 (3), 287-292 (2000)
   PUBMED   11256614
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB021011.1 and AK026909.1.
            On Oct 28, 2008 this sequence version replaced gi:9966798.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-52                DB021011.1         1-52
            53-2088             AK026909.1         2-2037
FEATURES             Location/Qualifiers
     source          1..2088
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="4"
                     /map="4q13.3"
     gene            1..2088
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /note="UTP3, small subunit (SSU) processome component,
                     homolog (S. cerevisiae)"
                     /db_xref="GeneID:57050"
                     /db_xref="HGNC:24477"
                     /db_xref="HPRD:18016"
                     /db_xref="MIM:611614"
     exon            1..2073
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /inference="alignment:Splign:1.39.8"
     variation       34
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368973346"
     variation       51
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:17735360"
     variation       55
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113215267"
     variation       80
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3733488"
     variation       183..184
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34165830"
     misc_feature    194..196
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /note="upstream in-frame stop codon"
     CDS             200..1639
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /note="charged amino acid rich leucine zipper 1 homolog;
                     disrupter of silencing 10; UTP3 homolog; disrupter of
                     silencing SAS10; charged amino acid-rich leucine zipper 1"
                     /codon_start=1
                     /product="something about silencing protein 10"
                     /protein_id="NP_065101.1"
                     /db_xref="GI:9966799"
                     /db_xref="CCDS:CCDS3546.1"
                     /db_xref="GeneID:57050"
                     /db_xref="HGNC:24477"
                     /db_xref="HPRD:18016"
                     /db_xref="MIM:611614"
                     /translation="
MVGRSRRRGAAKWAAVRAKAGPTLTDENGDDLGLPPSPGDTSYYQDQVDDFHEARSRAALAKGWNEVQSGDEEDGEEEEEEVLALDMDDEDDEDGGNAGEEEEEENADDDGGSSVQSEAEASVDPSLSWGQRKKLYYDTDYGSKSRGRQSQQEAEEEEREEEEEAQIIQRRLAQALQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQYLRTKYNLYLNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPKPKSVSKTSAAACAVTDLSDDSDFDEKAKLKYYKEIEDRQKLKRKKEENSTEEQALEDQNAKRAITYQIAKNRGLTPRRKKIDRNPRVKHREKFRRAKIRRRGQVREVRKEEQRYSGELSGIRAGVKKSIKLK
"
     misc_feature    308..310
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9NQZ2.1); phosphorylation site"
     misc_feature    308..310
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    647..649
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9NQZ2.1); phosphorylation site"
     misc_feature    647..649
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    884..1129
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /note="Sas10/Utp3/C1D family; Region: Sas10_Utp3;
                     pfam04000"
                     /db_xref="CDD:202850"
     misc_feature    1283..1285
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine; propagated from
                     UniProtKB/Swiss-Prot (Q9NQZ2.1); phosphorylation site"
     misc_feature    1292..1294
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9NQZ2.1); phosphorylation site"
     misc_feature    1292..1294
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    1301..1303
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9NQZ2.1); phosphorylation site"
     misc_feature    1301..1303
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    1406..1633
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /note="Sas10 C-terminal domain; Region: Sas10_Utp3_C;
                     pfam09368"
                     /db_xref="CDD:204214"
     variation       261
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200884643"
     variation       267
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16845385"
     variation       268
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143293658"
     variation       283
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16845387"
     variation       334
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141991251"
     variation       352
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138153717"
     variation       379
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:185831561"
     variation       388
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142687496"
     variation       415
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371426695"
     variation       426..428
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace=""
                     /replace="agg"
                     /db_xref="dbSNP:369776055"
     variation       452
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150580368"
     variation       476
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375905342"
     variation       496..498
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace=""
                     /replace="gga"
                     /db_xref="dbSNP:146575538"
     variation       506..508
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace=""
                     /replace="gag"
                     /db_xref="dbSNP:72049616"
     variation       512..514
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace=""
                     /replace="gag"
                     /db_xref="dbSNP:61104402"
     variation       514
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139575168"
     variation       515
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199884760"
     variation       538
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199724861"
     variation       540
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369756713"
     variation       559
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149285635"
     variation       565
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144519797"
     variation       566
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139549167"
     variation       643
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376391430"
     variation       657
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201931730"
     variation       659
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145063393"
     variation       670
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185662183"
     variation       674..675
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace=""
                     /replace="gag"
                     /db_xref="dbSNP:373643759"
     variation       675
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75530615"
     variation       682
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373204587"
     variation       714
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140266757"
     variation       769
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142982822"
     variation       779
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111485612"
     variation       804
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199913762"
     variation       814
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201070267"
     variation       858
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190818739"
     variation       917
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141044445"
     variation       921
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150243800"
     variation       939
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141537804"
     variation       1069
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146828085"
     variation       1078
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370336880"
     variation       1132
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11541969"
     variation       1156
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:182866939"
     variation       1166
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150475938"
     variation       1176
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376104894"
     variation       1228
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140595291"
     variation       1303
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145677997"
     variation       1312
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:34648105"
     variation       1362
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:373036425"
     variation       1378
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142723624"
     variation       1400
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200408107"
     variation       1403
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:143187619"
     variation       1428
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149552771"
     variation       1430
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376767606"
     variation       1461
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111975570"
     variation       1488
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202010379"
     variation       1504
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150767394"
     variation       1554
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140047180"
     variation       1563
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370936337"
     variation       1604
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375718549"
     variation       1641
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367902966"
     variation       1648
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377141669"
     STS             1656..1812
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /standard_name="SHGC-56824"
                     /db_xref="UniSTS:47185"
     variation       1697
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77013514"
     variation       1762
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:16845388"
     variation       1766
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:16845390"
     STS             1793..1912
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /standard_name="SHGC-67668"
                     /db_xref="UniSTS:2588"
     variation       1944
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187936171"
     variation       1958..1959
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35275699"
     variation       1987
                     /gene="UTP3"
                     /gene_synonym="CRL1; CRLZ1; SAS10"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:111479149"
ORIGIN      
aatcgtacgccacgcggagagcatgctgggggccggaaggaagaggaaattccagtagccgatcaggagtctgcaaactccggtggtaggggagcgcgctgctgtttagagccacgagttaccggagcgcctgattcctgcgccgaagtcagtggtggccgaaagtccggagtcgctgtaaaacctgagattgtgagccatggtggggagatcccggcggcgcggagcagctaagtgggcagctgtgcgagccaaggcaggtcccacgctcaccgacgaaaatggagatgatttaggattgccaccctcaccaggggacaccagctactaccaagatcaggtagatgactttcatgaggcacgatcccgggccgccttagctaagggctggaatgaagtacagagtggagacgaggaggatggcgaggaggaggaggaggaggtgctagccctagatatggacgatgaggacgacgaagatggagggaatgcgggggaggaggaggaggaggagaatgccgatgatgatggtgggagctccgtgcaaagtgaagctgaggcctctgtggatcccagtttgtcgtggggtcagaggaaaaaactttactatgacacggactatggttccaagtcccgaggccggcagagtcaacaggaggcagaggaggaggaaagagaggaggaggaggaggcacagatcattcagcggcgcctagcccaagcgctgcaagaggatgattttggtgtcgcctgggttgaggcctttgcaaaaccagtgcctcaggtagatgaggctgagacacgggtcgtgaaggatttggctaaagtttcagtgaaagagaagctgaaaatgttgcgaaaggaatcaccagaactcttggagctgatagaagacctgaaagtcaagttgacagaggttaaggatgagctggagccattgttagagttggtggaacaagggatcattccacccggaaaaggaagccaatacttgaggaccaagtacaacctctacttgaattattgctcgaacatcagtttttatttgatcctgaaagctaggagagtcccagcacatggacatcctgtcatagaaaggcttgttacctaccgaaatttgatcaacaagctgtccgttgtggatcagaagctgtcctcagaaattcgtcatctgttgacacttaaggatgatgctgtaaagaaagaactgattccaaaagcaaaatccaccaagcccaaaccaaagtctgtttcaaagacttctgctgctgcctgtgctgttacagatctttctgatgattctgattttgatgaaaaagcaaaactgaagtactataaagaaatagaagacaggcaaaagctaaagagaaagaaagaagaaaatagcactgaagaacaggctcttgaagatcaaaatgcaaagagagctattacctatcaaattgctaaaaataggggacttactcctaggagaaagaagattgatcgcaatcccagagtgaaacacagagagaagttcagaagagccaaaattagaagaagaggccaggttcgtgaagttcgtaaagaagagcaacgttatagtggtgaattatctggcattcgtgcaggagttaaaaagagcattaagcttaaatgaagtttttgcttagcataaggtttttggcagttttggatcaataaatttttacttttaactaaagtcattgtattaatatataatactttaaattttaaaaattcttgtccacaaggaaatttgtctgggttattggacaatttataagaactatgggagcaatatgaaggtgcttgagaaaagagatgatgttgaagttttccaatattctgttgaagttttccaatattaagtattagcttagggaaatttcacagttcattgtggagtgttaaacttagaacatgtgtaacttttcacataaagagaatgcatctttgacagttatcttatttgtaaggcagcctataaaatagttctgaagtattttatttacctaactataattattgggccagatacttgttaataaatgggcttaatgttaacatggaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:57050 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
            GeneID:57050 -> Biological process: GO:0007420 [brain development] evidence: ISS
            GeneID:57050 -> Biological process: GO:0016568 [chromatin modification] evidence: IEA
            GeneID:57050 -> Cellular component: GO:0005634 [nucleus] evidence: ISS
            GeneID:57050 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.