Home |
Help |
Advanced search
2024-04-16 15:32:39, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_020313 2106 bp mRNA linear PRI 01-JUL-2013
DEFINITION Homo sapiens cytokine induced apoptosis inhibitor 1 (CIAPIN1),
mRNA.
ACCESSION NM_020313
VERSION NM_020313.2 GI:89274168
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2106)
AUTHORS Banci,L., Bertini,I., Calderone,V., Ciofi-Baffoni,S., Giachetti,A.,
Jaiswal,D., Mikolajczyk,M., Piccioli,M. and Winkelmann,J.
TITLE Molecular view of an electron transfer process essential for
iron-sulfur protein biogenesis
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 110 (18), 7136-7141 (2013)
PUBMED 23596212
REMARK GeneRIF: the molecular basis of recognition between Ndor1 and
anamorsin and of the electron transfer process, was investigated.
REFERENCE 2 (bases 1 to 2106)
AUTHORS Chen,X., Li,X., Chen,J., Zheng,P., Huang,S. and Ouyang,X.
TITLE Overexpression of CIAPIN1 inhibited pancreatic cancer cell
proliferation and was associated with good prognosis in pancreatic
cancer
JOURNAL Cancer Gene Ther. 19 (8), 538-544 (2012)
PUBMED 22677939
REMARK GeneRIF: In summary, our work revealed a novel function of CIAPIN1,
which might possibly be used as an independent prognostic factor
and a potential therapeutic target for pancreatic cancer
REFERENCE 3 (bases 1 to 2106)
AUTHORS Cai,X., Wang,J. and Xin,X.
TITLE CIAPIN1 nuclear accumulation predicts poor clinical outcome in
epithelial ovarian cancer
JOURNAL World J Surg Oncol 10, 112 (2012)
PUBMED 22713669
REMARK GeneRIF: Elevated expression of nuclear CIAPIN1 negatively
correlated with the survival of epithelial ovarian cancer patients
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 2106)
AUTHORS Banci,L., Bertini,I., Ciofi-Baffoni,S., Boscaro,F., Chatzi,A.,
Mikolajczyk,M., Tokatlidis,K. and Winkelmann,J.
TITLE Anamorsin is a [2Fe-2S] cluster-containing substrate of the
Mia40-dependent mitochondrial protein trapping machinery
JOURNAL Chem. Biol. 18 (6), 794-804 (2011)
PUBMED 21700214
REMARK GeneRIF: Anamorsin is a Mia40-dependent but ALR-independent
IMS-protein and binds a [2Fe-2S] cluster before and after specific
Mia40-driven Cys-oxidation.
REFERENCE 5 (bases 1 to 2106)
AUTHORS Li,B., Li,Q.H., Lin,Y.N., Jin,W.N. and Pang,T.X.
TITLE [Expression of CIAPIN1 gene in BMMNC of patients with leukemia]
JOURNAL Zhongguo Shi Yan Xue Ye Xue Za Zhi 19 (3), 570-573 (2011)
PUBMED 21729524
REMARK GeneRIF: Up-regulation of CIAPIN1 expression may play an important
role in pathogenesis of leukemia.
REFERENCE 6 (bases 1 to 2106)
AUTHORS Hao,Z., Li,X., Qiao,T. and Fan,D.
TITLE Successful expression and purification of human CIAPIN1 in
baculovirus-insect cell system and application of this system to
investigation of its potential methyltransferase activity
JOURNAL Int. J. Biol. Macromol. 42 (1), 27-32 (2008)
PUBMED 17935775
REMARK GeneRIF: CIAPIN1 might be a DNA or RNA methyltransferase.
REFERENCE 7 (bases 1 to 2106)
AUTHORS Hao,Z., Li,X., Qiao,T., Du,R., Zhang,G. and Fan,D.
TITLE Subcellular localization of CIAPIN1
JOURNAL J. Histochem. Cytochem. 54 (12), 1437-1444 (2006)
PUBMED 16957168
REMARK GeneRIF: CIAPIN1 was localized in both the cytoplasm and the
nucleus and was accumulated in the nucleolus. Bioinformatic
prediction disclosed a putative nuclear localization signal and a
putative nuclear export signal within human CIAPIN1.
REFERENCE 8 (bases 1 to 2106)
AUTHORS Hao,Z., Li,X., Qiao,T., Du,R., Hong,L. and Fan,D.
TITLE CIAPIN1 confers multidrug resistance by upregulating the expression
of MDR-1 and MRP-1 in gastric cancer cells
JOURNAL Cancer Biol. Ther. 5 (3), 261-266 (2006)
PUBMED 16410721
REMARK GeneRIF: it is concluded that CIAPIN1 confers multidrug resistance
in gastric cancer cells, likely by upregulating MDR-1 and MRP-1
REFERENCE 9 (bases 1 to 2106)
AUTHORS Shibayama,H., Takai,E., Matsumura,I., Kouno,M., Morii,E.,
Kitamura,Y., Takeda,J. and Kanakura,Y.
TITLE Identification of a cytokine-induced antiapoptotic molecule
anamorsin essential for definitive hematopoiesis
JOURNAL J. Exp. Med. 199 (4), 581-592 (2004)
PUBMED 14970183
REFERENCE 10 (bases 1 to 2106)
AUTHORS Loftus,B.J., Kim,U.J., Sneddon,V.P., Kalush,F., Brandon,R.,
Fuhrmann,J., Mason,T., Crosby,M.L., Barnstead,M., Cronin,L.,
Deslattes Mays,A., Cao,Y., Xu,R.X., Kang,H.L., Mitchell,S.,
Eichler,E.E., Harris,P.C., Venter,J.C. and Adams,M.D.
TITLE Genome duplications and other features in 12 Mb of DNA sequence
from human chromosome 16p and 16q
JOURNAL Genomics 60 (3), 295-308 (1999)
PUBMED 10493829
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BC067303.1, BC024196.2 and AF248964.1.
On Mar 9, 2006 this sequence version replaced gi:10092672.
Summary: CIAPIN1 is a cytokine-induced inhibitor of apoptosis with
no relation to apoptosis regulatory molecules of the BCL2 (MIM
151430) or CASP (see MIM 147678) families. Expression of CIAPIN1 is
dependent on growth factor stimulation (Shibayama et al., 2004
[PubMed 14970183]).[supplied by OMIM, Mar 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF248964.1, BC067303.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-64 BC067303.1 72-135
65-980 BC024196.2 17-932
981-1732 BC067303.1 1052-1803
1733-2106 AF248964.1 1708-2081
FEATURES Location/Qualifiers
source 1..2106
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="16"
/map="16q21"
gene 1..2106
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/note="cytokine induced apoptosis inhibitor 1"
/db_xref="GeneID:57019"
/db_xref="HGNC:28050"
/db_xref="MIM:608943"
exon 1..116
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
STS 56..1617
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/standard_name="ha3079"
/db_xref="UniSTS:515639"
exon 117..328
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
misc_feature 145..147
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/note="upstream in-frame stop codon"
CDS 172..1110
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/note="predicted protein of HQ0915; cytokine-induced
apoptosis inhibitor 1; fe-S cluster assembly protein DRE2
homolog"
/codon_start=1
/product="anamorsin"
/protein_id="NP_064709.2"
/db_xref="GI:89274169"
/db_xref="CCDS:CCDS10781.2"
/db_xref="GeneID:57019"
/db_xref="HGNC:28050"
/db_xref="MIM:608943"
/translation="
MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
"
misc_feature 193..459
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/note="S-adenosylmethionine-dependent methyltransferases
(SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
that use S-adenosyl-L-methionine (SAM or AdoMet) as a
substrate for methyltransfer, creating the product
S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
cd02440"
/db_xref="CDD:100107"
misc_feature 715..717
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q6FI81.2); phosphorylation site"
misc_feature 718..720
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q6FI81.2); phosphorylation site"
misc_feature 718..720
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 835..1083
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/note="Cytokine-induced anti-apoptosis inhibitor 1, Fe-S
biogenesis; Region: CIAPIN1; pfam05093"
/db_xref="CDD:191190"
misc_feature 1084..1086
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q6FI81.2); phosphorylation site"
misc_feature 1090..1092
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q6FI81.2); phosphorylation site"
variation 227
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/replace="c"
/replace="t"
/db_xref="dbSNP:1043126"
variation 272
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/replace="a"
/replace="c"
/db_xref="dbSNP:11557672"
variation 325
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/replace="c"
/replace="g"
/db_xref="dbSNP:11557674"
exon 329..481
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
variation 378
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/replace="a"
/replace="g"
/db_xref="dbSNP:11557673"
exon 482..558
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
exon 559..727
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
exon 728..801
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
exon 802..917
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
exon 918..999
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
exon 1000..2106
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/inference="alignment:Splign:1.39.8"
STS 1478..1673
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/standard_name="IB525"
/db_xref="UniSTS:25848"
STS 1545..1688
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/standard_name="RH11736"
/db_xref="UniSTS:84285"
STS 1817..2034
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/standard_name="A007G23"
/db_xref="UniSTS:7263"
STS 1889..2009
/gene="CIAPIN1"
/gene_synonym="2810413N20Rik; Anamorsin; DRE2; PRO0915"
/standard_name="SHGC-61194"
/db_xref="UniSTS:21097"
ORIGIN
accacggccctaaggagggcggaagtcgtcgctccgtggagcctcctcctctcgcgagaggcgcaaggcgtggagtcgacggctggagagaagccgggagcgagcccaggcggcagtcttgattcccttttggccagcagtttttaggtctgtcagtactgcactgcaagaatggcagattttgggatctctgctggccagtttgtggcagtggtctgggataagtcatccccagtggaggctctgaaaggtctggtggataagcttcaagcgttaaccggcaatgagggccgcgtgtctgtggaaaacatcaagcagctgttgcaatctgcccacaaagaatccagctttgacattattttgtcaggtttagtcccaggaagcaccactctgcacagtgctgagattttggctgaaatcgcccggatccttcggcctggtggatgtctttttctgaaggagccagtagagacagctgtagataacaatagcaaagtgaagacagcatctaagctgtgttcagccctgactctttctggtcttgtggaagtgaaagagctgcagcgggagcccctaacccctgaggaagtacagtctgttcgagaacaccttggtcatgaaagtgacaacctgctgtttgttcagatcacaggcaaaaaaccaaactttgaagtgggttcttctaggcagcttaagctttccatcaccaagaagtcttctccttcagtgaaacctgctgtggaccctgctgctgccaagctgtggaccctctcagccaacgatatggaggacgacagcatggatctcattgactcagatgagctgctggatccagaagatttgaagaagccagatccagcttccctgcgggctgcttcttgtggggaagggaaaaagaggaaggcctgtaagaactgcacctgtggccttgccgaagaactggaaaaagagaagtcaagggaacagatgagctcccaacccaagtcagcttgtggaaactgctacctgggcgatgccttccgctgtgccagctgcccctaccttgggatgccagccttcaaacctggggaaaaggtgcttctgagtgatagcaatcttcatgatgcctaggaggttcctgacatgggacccatctgctcctccagccaactcctgtccctcacatcccaccatggtggctcctcccacctcctctggatttgttcactctgagatctgtttgcagagtgggtgcttagcagacagagtgaagctggctggggggcacagtggtgtgtagtgctgctgtgtatcaaaagaccaaggtattatgggacctggtttcagaatgggatgggtttcttcacctcatgttaagagaagggagtgtgtcctgaagaagcccttcttctgatgttaaaatgctgaccagaacgctcttgagcccaggcatcgttgagcattaacactctgtgacagagctgcagacccctgccttgagtctcatctcagcaatgctgccaccctcttgtctttcagagttgttagtttactccattctttgtgacacgagtcaagtggctcacaacctcctcagggcaccagaggactcactcactggttgctgtgatgatatccagtgtccctctgcccccttccatccccaaccacatttgactgtagcattgcatctgtgtcctgttgtcatttatgttaaccttcaggtattaaacttgctgcatatcttgacatatcttgagattctgcatgtcttgtaaagagaggggatgtgcatttgtgtgtgatgttggatagtcatccacgctcagtttggaccattggaggaacttagtgtcacgcacaaatggggctattcctacgcttagaatagggcttgtctgcccactttagaagagtccaggttggtgagcatttagagggaagcagggcagaactctgaacgacaatacgtctctctgagcagagacccctttgttcttgttatccacccatatggacttggaatcaatcttgccaaatatttggagagattgtgtggatttaagagacctggatttttatattttaccagtaaataaaagttttcattgatatctgtccttgaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:57019 -> Molecular function: GO:0051536 [iron-sulfur cluster binding] evidence: IEA
GeneID:57019 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:57019 -> Biological process: GO:0016226 [iron-sulfur cluster assembly] evidence: IEA
GeneID:57019 -> Biological process: GO:0030097 [hemopoiesis] evidence: IEA
GeneID:57019 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: ISS
GeneID:57019 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:57019 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:57019 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:57019 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:57019 -> Cellular component: GO:0005737 [cytoplasm] evidence: ISS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.