2024-04-26 09:58:18, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_019884 2200 bp mRNA linear PRI 19-MAY-2013 DEFINITION Homo sapiens glycogen synthase kinase 3 alpha (GSK3A), mRNA. ACCESSION NM_019884 VERSION NM_019884.2 GI:49574531 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2200) AUTHORS Rahmani,M., Aust,M.M., Attkisson,E., Williams,D.C. Jr., Ferreira-Gonzalez,A. and Grant,S. TITLE Dual inhibition of Bcl-2 and Bcl-xL strikingly enhances PI3K inhibition-induced apoptosis in human myeloid leukemia cells through a GSK3- and Bim-dependent mechanism JOURNAL Cancer Res. 73 (4), 1340-1351 (2013) PUBMED 23243017 REMARK GeneRIF: Findings suggest that inhibiton of Bcl-2, Bcl-xL and PI3K, and release of Bim from Bcl-2/Bcl-xL and GSK3alpha/beta culminating in Bax/Bak activation and apoptosis. REFERENCE 2 (bases 1 to 2200) AUTHORS Linke,R., Pries,R., Konnecke,M., Bruchhage,K.L., Boscke,R., Gebhard,M. and Wollenberg,B. TITLE Glycogen synthase kinase 3 in chronic rhinosinusitis: two faces of a single enzyme in one disease JOURNAL Ann. Allergy Asthma Immunol. 110 (2), 101-106 (2013) PUBMED 23352529 REMARK GeneRIF: GSK-3 may play a crucial role in the inflammatory process in chronic rhinosinusitis with nasal polyps (CRSwNP). REFERENCE 3 (bases 1 to 2200) AUTHORS Mammano,E., Galdi,F., Pierobon,M., Tessari,E., Deng,J., Pucciarelli,S., Agostini,M., De Marchi,F., Canzonieri,V., De Paoli,A., Belluco,C., Liotta,L., Petricoin,E., Pilati,P. and Nitti,D. TITLE Multiplexed protein signal pathway mapping identifies patients with rectal cancer that responds to neoadjuvant treatment JOURNAL Clin Colorectal Cancer 11 (4), 268-274 (2012) PUBMED 22658458 REMARK GeneRIF: Lower phosphorylation levels of GSK3A is associated with poor treatment response in rectal cancer. REFERENCE 4 (bases 1 to 2200) AUTHORS Lin,S.Y., Li,T.Y., Liu,Q., Zhang,C., Li,X., Chen,Y., Zhang,S.M., Lian,G., Liu,Q., Ruan,K., Wang,Z., Zhang,C.S., Chien,K.Y., Wu,J., Li,Q., Han,J. and Lin,S.C. TITLE GSK3-TIP60-ULK1 signaling pathway links growth factor deprivation to autophagy JOURNAL Science 336 (6080), 477-481 (2012) PUBMED 22539723 REMARK GeneRIF: glycogen synthase kinase-3 (GSK3), when deinhibited by default in cells deprived of growth factors, activates acetyltransferase TIP60 through phosphorylating TIP60-Ser86, which acetylates and stimulates the protein kinase ULK1, which is required for autophagy Erratum:[Science. 2012 Aug 17;337(6096):799] REFERENCE 5 (bases 1 to 2200) AUTHORS Lu,F.F., Su,P., Liu,F. and Daskalakis,Z.J. TITLE Activation of GABA(B) receptors inhibits protein kinase B/glycogen synthase kinase 3 signaling JOURNAL Mol Brain 5, 41 (2012) PUBMED 23192081 REMARK GeneRIF: Activation of GABA(B) receptors significantly inhibits Akt/GSK-3 signaling in a beta-arrestin-dependent pathway. Publication Status: Online-Only REFERENCE 6 (bases 1 to 2200) AUTHORS Shaw,P.C., Davies,A.F., Lau,K.F., Garcia-Barcelo,M., Waye,M.M., Lovestone,S., Miller,C.C. and Anderton,B.H. TITLE Isolation and chromosomal mapping of human glycogen synthase kinase-3 alpha and -3 beta encoding genes JOURNAL Genome 41 (5), 720-727 (1998) PUBMED 9809441 REFERENCE 7 (bases 1 to 2200) AUTHORS Harr,S.D., Hollister,R.D. and Hyman,B.T. TITLE Glycogen synthase kinase 3 alpha and 3 beta do not colocalize with neurofibrillary tangles JOURNAL Neurobiol. Aging 17 (3), 343-348 (1996) PUBMED 8725894 REFERENCE 8 (bases 1 to 2200) AUTHORS Cross,D.A., Alessi,D.R., Cohen,P., Andjelkovich,M. and Hemmings,B.A. TITLE Inhibition of glycogen synthase kinase-3 by insulin mediated by protein kinase B JOURNAL Nature 378 (6559), 785-789 (1995) PUBMED 8524413 REFERENCE 9 (bases 1 to 2200) AUTHORS He,X., Saint-Jeannet,J.P., Woodgett,J.R., Varmus,H.E. and Dawid,I.B. TITLE Glycogen synthase kinase-3 and dorsoventral patterning in Xenopus embryos JOURNAL Nature 374 (6523), 617-622 (1995) PUBMED 7715701 REMARK Erratum:[Nature 1995 May 18;375(6528):253] REFERENCE 10 (bases 1 to 2200) AUTHORS Yang,S.D., Yu,J.S., Shiah,S.G. and Huang,J.J. TITLE Protein kinase FA/glycogen synthase kinase-3 alpha after heparin potentiation phosphorylates tau on sites abnormally phosphorylated in Alzheimer's disease brain JOURNAL J. Neurochem. 63 (4), 1416-1425 (1994) PUBMED 7931292 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from BC027984.1, L40027.1, D63424.1 and BC051865.2. On Jul 1, 2004 this sequence version replaced gi:11995473. Summary: This gene encodes a multifunctional Ser/Thr protein kinase that is implicated in the control of several regulatory proteins including glycogen synthase, and transcription factors, such as JUN. It also plays a role in the WNT and PI3K signaling pathways, as well as regulates the production of beta-amyloid peptides associated with Alzheimer's disease. [provided by RefSeq, Oct 2011]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC051865.2, BC027984.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1438 BC027984.1 20-1457 1439-1440 L40027.1 1434-1435 1441-2182 D63424.1 1413-2154 2183-2189 BC027984.1 2202-2208 2190-2200 BC051865.2 2179-2189 FEATURES Location/Qualifiers source 1..2200 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="19" /map="19q13.2" gene 1..2200 /gene="GSK3A" /note="glycogen synthase kinase 3 alpha" /db_xref="GeneID:2931" /db_xref="HGNC:4616" /db_xref="MIM:606784" exon 1..402 /gene="GSK3A" /inference="alignment:Splign:1.39.8" CDS 120..1571 /gene="GSK3A" /EC_number="2.7.11.1" /EC_number="2.7.11.26" /note="GSK-3 alpha; serine/threonine-protein kinase GSK3A" /codon_start=1 /product="glycogen synthase kinase-3 alpha" /protein_id="NP_063937.2" /db_xref="GI:49574532" /db_xref="CCDS:CCDS12599.1" /db_xref="GeneID:2931" /db_xref="HGNC:4616" /db_xref="MIM:606784" /translation="
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS
" misc_feature 123..125 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="N-acetylserine; propagated from UniProtKB/Swiss-Prot (P49840.2); acetylation site" misc_feature 123..125 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P49840.2); phosphorylation site" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by PKB/AKT1; propagated from UniProtKB/Swiss-Prot (P49840.2); phosphorylation site" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01498" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01499" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01501" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:01502" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03382" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:06151" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:06349" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[8] /db_xref="HPRD:01261" misc_feature 180..182 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:04264" misc_feature 333..335 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P49840.2); phosphorylation site" misc_feature 348..350 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P49840.2); phosphorylation site" misc_feature 408..410 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P49840.2); phosphorylation site" misc_feature 474..1328 /gene="GSK3A" /note="Protein Kinases, catalytic domain; Region: PKc_like; cl09925" /db_xref="CDD:213116" misc_feature 474..1328 /gene="GSK3A" /note="Protein kinase domain; Region: Pkinase; pfam00069" /db_xref="CDD:200973" misc_feature order(492..506,516..518,555..557,561..563,636..638, 702..713,729..731,735..737,849..851,855..857,861..866, 870..872,906..908,915..917,960..971) /gene="GSK3A" /note="active site" /db_xref="CDD:173623" misc_feature order(492..506,516..518,555..557,561..563,636..638, 702..713,729..731,849..851,855..857,861..866,870..872, 906..908) /gene="GSK3A" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:173623" misc_feature order(504..506,729..731,735..737,849..851,855..857, 861..863,915..917,960..971) /gene="GSK3A" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:173623" misc_feature order(903..923,960..971) /gene="GSK3A" /note="activation loop (A-loop); other site" /db_xref="CDD:173623" misc_feature 951..953 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:06002" misc_feature 954..956 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 954..956 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" misc_feature 954..956 /gene="GSK3A" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:06002" exon 403..590 /gene="GSK3A" /inference="alignment:Splign:1.39.8" STS 414..564 /gene="GSK3A" /standard_name="D19S688E" /db_xref="UniSTS:150587" exon 591..674 /gene="GSK3A" /inference="alignment:Splign:1.39.8" exon 675..785 /gene="GSK3A" /inference="alignment:Splign:1.39.8" STS 753..815 /gene="GSK3A" /standard_name="MARC_17709-17710:1031755211:1" /db_xref="UniSTS:268383" exon 786..916 /gene="GSK3A" /inference="alignment:Splign:1.39.8" exon 917..1023 /gene="GSK3A" /inference="alignment:Splign:1.39.8" exon 1024..1121 /gene="GSK3A" /inference="alignment:Splign:1.39.8" STS 1122..1355 /gene="GSK3A" /standard_name="RH11670" /db_xref="UniSTS:39033" exon 1122..1217 /gene="GSK3A" /inference="alignment:Splign:1.39.8" STS 1213..1355 /gene="GSK3A" /standard_name="SHGC-32066" /db_xref="UniSTS:39032" exon 1218..1404 /gene="GSK3A" /inference="alignment:Splign:1.39.8" exon 1405..1497 /gene="GSK3A" /inference="alignment:Splign:1.39.8" exon 1498..2179 /gene="GSK3A" /inference="alignment:Splign:1.39.8" variation 1835 /gene="GSK3A" /replace="c" /replace="t" /db_xref="dbSNP:1054311" STS 1914..1999 /gene="GSK3A" /standard_name="D19S656E" /db_xref="UniSTS:150570" variation 2041 /gene="GSK3A" /replace="c" /replace="t" /db_xref="dbSNP:1054318" variation 2097 /gene="GSK3A" /replace="a" /replace="g" /db_xref="dbSNP:1802524" variation 2111 /gene="GSK3A" /replace="c" /replace="t" /db_xref="dbSNP:1054370" variation 2121 /gene="GSK3A" /replace="a" /replace="c" /db_xref="dbSNP:1054371" ORIGIN
cccaagccagagcggcgcggcctggaagaggccagggcccgggggaggcggcggcagcggcggcggctggggcagcccgggcagcccgagccccgcagcctgggcctgtgctcggcgccatgagcggcggcgggccttcgggaggcggccctgggggctcgggcagggcgcggactagctcgttcgcggagcccggcggcggaggcggaggaggcggcggcggccccggaggctcggcctccggcccaggcggcaccggcggcggaaaggcatctgtcggggccatgggtgggggcgtcggggcctcgagctccgggggtggacccggcggcagcggcggaggaggcagcggaggccccggcgcaggcactagcttcccgccgcccggggtgaagctgggccgtgacagcgggaaggtgaccacagtcgtagccactctaggccaaggcccagagcgctcccaagaagtggcttacacggacatcaaagtgattggcaatggctcatttggggtcgtgtaccaggcacggctggcagagaccagggaactagtcgccatcaagaaggttctccaggacaagaggttcaagaaccgagagctgcagatcatgcgtaagctggaccactgcaatattgtgaggctgagatactttttctactccagtggcgagaagaaagacgagctttacctaaatctggtgctggaatatgtgcccgagacagtgtaccgggtggcccgccacttcaccaaggccaagttgaccatccctatcctctatgtcaaggtgtacatgtaccagctcttccgcagcttggcctacatccactcccagggcgtgtgtcaccgcgacatcaagccccagaacctgctggtggaccctgacactgctgtcctcaagctctgcgattttggcagtgcaaagcagttggtccgaggggagcccaatgtctcctacatctgttctcgctactaccgggccccagagctcatctttggagccactgattacacctcatccatcgatgtttggtcagctggctgtgtactggcagagctcctcttgggccagcccatcttccctggggacagtggggtggaccagctggtggagatcatcaaggtgctgggaacaccaacccgggaacaaatccgagagatgaaccccaactacacggagttcaagttccctcagattaaagctcacccctggacaaaggtgttcaaatctcgaacgccgccagaggccatcgcgctctgctctagcctgctggagtacaccccatcctcaaggctctccccactagaggcctgtgcgcacagcttctttgatgaactgcgatgtctgggaacccagctgcctaacaaccgcccacttccccctctcttcaacttcagtgctggtgaactctccatccaaccgtctctcaacgccattctcatccctcctcacttgaggtccccagcgggcactaccaccctcaccccgtcctcacaagctttaactgagactccgaccagctcagactggcagtcgaccgatgccacacctaccctcactaactcctcctgagggccccaccaagcacccttccacttccatctgggagccccaagaggggctgggaaggggggccatagcccatcaagctcctgccctggctgggcccctagactagagggcagaggtaaatgagtccctgtccccacctccagtccctccctcaccagcctcacccctgtggtgggctttttaagaggattttaactggttgtggggagggaagagaaggacagggtgttggggggatgaggacctcctacccccttggccccctcccctcccccagacctccacctcctccagaccccctcccctcctgtgtcccttgtaaatagaaccagcccagcccgtctcctcttcccttccctggcccccgggtgtaaatagattgttataatttttttcttaaagaaaacgtcgattcgcaccgtccaacctggccccgcccctcctacagctgtaactcccctcctgtcctctgcccccaaggtctactccctcctcaccccaccctggagggccaggggagtggagagagctcctgatgtcttagtttccacagtaaggtttgcctgtgtacagacctccgttcaataaattattggcatgaaaacctgaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:2931 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA GeneID:2931 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:2931 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA GeneID:2931 -> Molecular function: GO:0034236 [protein kinase A catalytic subunit binding] evidence: IPI GeneID:2931 -> Molecular function: GO:0050321 [tau-protein kinase activity] evidence: TAS GeneID:2931 -> Biological process: GO:0003073 [regulation of systemic arterial blood pressure] evidence: ISS GeneID:2931 -> Biological process: GO:0003214 [cardiac left ventricle morphogenesis] evidence: ISS GeneID:2931 -> Biological process: GO:0005977 [glycogen metabolic process] evidence: IEA GeneID:2931 -> Biological process: GO:0006349 [regulation of gene expression by genetic imprinting] evidence: IEA GeneID:2931 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA GeneID:2931 -> Biological process: GO:0006987 [activation of signaling protein activity involved in unfolded protein response] evidence: TAS GeneID:2931 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS GeneID:2931 -> Biological process: GO:0007399 [nervous system development] evidence: IEA GeneID:2931 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: ISS GeneID:2931 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS GeneID:2931 -> Biological process: GO:0010800 [positive regulation of peptidyl-threonine phosphorylation] evidence: IEA GeneID:2931 -> Biological process: GO:0010905 [negative regulation of UDP-glucose catabolic process] evidence: IC GeneID:2931 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA GeneID:2931 -> Biological process: GO:0016477 [cell migration] evidence: IEA GeneID:2931 -> Biological process: GO:0030819 [positive regulation of cAMP biosynthetic process] evidence: ISS GeneID:2931 -> Biological process: GO:0030968 [endoplasmic reticulum unfolded protein response] evidence: TAS GeneID:2931 -> Biological process: GO:0032007 [negative regulation of TOR signaling cascade] evidence: ISS GeneID:2931 -> Biological process: GO:0032869 [cellular response to insulin stimulus] evidence: IMP GeneID:2931 -> Biological process: GO:0033138 [positive regulation of peptidyl-serine phosphorylation] evidence: IEA GeneID:2931 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS GeneID:2931 -> Biological process: GO:0044027 [hypermethylation of CpG island] evidence: IEA GeneID:2931 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS GeneID:2931 -> Biological process: GO:0045087 [innate immune response] evidence: TAS GeneID:2931 -> Biological process: GO:0045719 [negative regulation of glycogen biosynthetic process] evidence: TAS GeneID:2931 -> Biological process: GO:0045732 [positive regulation of protein catabolic process] evidence: NAS GeneID:2931 -> Biological process: GO:0045823 [positive regulation of heart contraction] evidence: ISS GeneID:2931 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA GeneID:2931 -> Biological process: GO:0046325 [negative regulation of glucose import] evidence: IMP GeneID:2931 -> Biological process: GO:0046627 [negative regulation of insulin receptor signaling pathway] evidence: IMP GeneID:2931 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS GeneID:2931 -> Biological process: GO:0048015 [phosphatidylinositol-mediated signaling] evidence: TAS GeneID:2931 -> Biological process: GO:0051348 [negative regulation of transferase activity] evidence: IMP GeneID:2931 -> Biological process: GO:0061052 [negative regulation of cell growth involved in cardiac muscle cell development] evidence: ISS GeneID:2931 -> Biological process: GO:0071285 [cellular response to lithium ion] evidence: IEA GeneID:2931 -> Biological process: GO:0071407 [cellular response to organic cyclic compound] evidence: IEA GeneID:2931 -> Biological process: GO:0071879 [positive regulation of adrenergic receptor signaling pathway] evidence: ISS GeneID:2931 -> Biological process: GO:0090090 [negative regulation of canonical Wnt receptor signaling pathway] evidence: TAS GeneID:2931 -> Biological process: GO:2000077 [negative regulation of type B pancreatic cell development] evidence: TAS GeneID:2931 -> Biological process: GO:2000466 [negative regulation of glycogen (starch) synthase activity] evidence: TAS GeneID:2931 -> Biological process: GO:2000467 [positive regulation of glycogen (starch) synthase activity] evidence: ISS GeneID:2931 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:2931 -> Cellular component: GO:0030877 [beta-catenin destruction complex] evidence: NAS GeneID:2931 -> Cellular component: GO:0030877 [beta-catenin destruction complex] evidence: TAS ANNOTATIONS from NCBI Entrez Gene (20130726): NP_063937 -> EC 2.7.11.1 NP_063937 -> EC 2.7.11.26
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.