GGRNA Home | Help | Advanced search

2020-10-26 18:34:03, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_019884               2200 bp    mRNA    linear   PRI 19-MAY-2013
DEFINITION  Homo sapiens glycogen synthase kinase 3 alpha (GSK3A), mRNA.
ACCESSION   NM_019884
VERSION     NM_019884.2  GI:49574531
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2200)
  AUTHORS   Rahmani,M., Aust,M.M., Attkisson,E., Williams,D.C. Jr.,
            Ferreira-Gonzalez,A. and Grant,S.
  TITLE     Dual inhibition of Bcl-2 and Bcl-xL strikingly enhances PI3K
            inhibition-induced apoptosis in human myeloid leukemia cells
            through a GSK3- and Bim-dependent mechanism
  JOURNAL   Cancer Res. 73 (4), 1340-1351 (2013)
   PUBMED   23243017
  REMARK    GeneRIF: Findings suggest that inhibiton of Bcl-2, Bcl-xL and PI3K,
            and release of Bim from Bcl-2/Bcl-xL and GSK3alpha/beta culminating
            in Bax/Bak activation and apoptosis.
REFERENCE   2  (bases 1 to 2200)
  AUTHORS   Linke,R., Pries,R., Konnecke,M., Bruchhage,K.L., Boscke,R.,
            Gebhard,M. and Wollenberg,B.
  TITLE     Glycogen synthase kinase 3 in chronic rhinosinusitis: two faces of
            a single enzyme in one disease
  JOURNAL   Ann. Allergy Asthma Immunol. 110 (2), 101-106 (2013)
   PUBMED   23352529
  REMARK    GeneRIF: GSK-3 may play a crucial role in the inflammatory process
            in chronic rhinosinusitis with nasal polyps (CRSwNP).
REFERENCE   3  (bases 1 to 2200)
  AUTHORS   Mammano,E., Galdi,F., Pierobon,M., Tessari,E., Deng,J.,
            Pucciarelli,S., Agostini,M., De Marchi,F., Canzonieri,V., De
            Paoli,A., Belluco,C., Liotta,L., Petricoin,E., Pilati,P. and
            Nitti,D.
  TITLE     Multiplexed protein signal pathway mapping identifies patients with
            rectal cancer that responds to neoadjuvant treatment
  JOURNAL   Clin Colorectal Cancer 11 (4), 268-274 (2012)
   PUBMED   22658458
  REMARK    GeneRIF: Lower phosphorylation levels of GSK3A is associated with
            poor treatment response in rectal cancer.
REFERENCE   4  (bases 1 to 2200)
  AUTHORS   Lin,S.Y., Li,T.Y., Liu,Q., Zhang,C., Li,X., Chen,Y., Zhang,S.M.,
            Lian,G., Liu,Q., Ruan,K., Wang,Z., Zhang,C.S., Chien,K.Y., Wu,J.,
            Li,Q., Han,J. and Lin,S.C.
  TITLE     GSK3-TIP60-ULK1 signaling pathway links growth factor deprivation
            to autophagy
  JOURNAL   Science 336 (6080), 477-481 (2012)
   PUBMED   22539723
  REMARK    GeneRIF: glycogen synthase kinase-3 (GSK3), when deinhibited by
            default in cells deprived of growth factors, activates
            acetyltransferase TIP60 through phosphorylating TIP60-Ser86, which
            acetylates and stimulates the protein kinase ULK1, which is
            required for autophagy
            Erratum:[Science. 2012 Aug 17;337(6096):799]
REFERENCE   5  (bases 1 to 2200)
  AUTHORS   Lu,F.F., Su,P., Liu,F. and Daskalakis,Z.J.
  TITLE     Activation of GABA(B) receptors inhibits protein kinase B/glycogen
            synthase kinase 3 signaling
  JOURNAL   Mol Brain 5, 41 (2012)
   PUBMED   23192081
  REMARK    GeneRIF: Activation of GABA(B) receptors significantly inhibits
            Akt/GSK-3 signaling in a beta-arrestin-dependent pathway.
            Publication Status: Online-Only
REFERENCE   6  (bases 1 to 2200)
  AUTHORS   Shaw,P.C., Davies,A.F., Lau,K.F., Garcia-Barcelo,M., Waye,M.M.,
            Lovestone,S., Miller,C.C. and Anderton,B.H.
  TITLE     Isolation and chromosomal mapping of human glycogen synthase
            kinase-3 alpha and -3 beta encoding genes
  JOURNAL   Genome 41 (5), 720-727 (1998)
   PUBMED   9809441
REFERENCE   7  (bases 1 to 2200)
  AUTHORS   Harr,S.D., Hollister,R.D. and Hyman,B.T.
  TITLE     Glycogen synthase kinase 3 alpha and 3 beta do not colocalize with
            neurofibrillary tangles
  JOURNAL   Neurobiol. Aging 17 (3), 343-348 (1996)
   PUBMED   8725894
REFERENCE   8  (bases 1 to 2200)
  AUTHORS   Cross,D.A., Alessi,D.R., Cohen,P., Andjelkovich,M. and
            Hemmings,B.A.
  TITLE     Inhibition of glycogen synthase kinase-3 by insulin mediated by
            protein kinase B
  JOURNAL   Nature 378 (6559), 785-789 (1995)
   PUBMED   8524413
REFERENCE   9  (bases 1 to 2200)
  AUTHORS   He,X., Saint-Jeannet,J.P., Woodgett,J.R., Varmus,H.E. and
            Dawid,I.B.
  TITLE     Glycogen synthase kinase-3 and dorsoventral patterning in Xenopus
            embryos
  JOURNAL   Nature 374 (6523), 617-622 (1995)
   PUBMED   7715701
  REMARK    Erratum:[Nature 1995 May 18;375(6528):253]
REFERENCE   10 (bases 1 to 2200)
  AUTHORS   Yang,S.D., Yu,J.S., Shiah,S.G. and Huang,J.J.
  TITLE     Protein kinase FA/glycogen synthase kinase-3 alpha after heparin
            potentiation phosphorylates tau on sites abnormally phosphorylated
            in Alzheimer's disease brain
  JOURNAL   J. Neurochem. 63 (4), 1416-1425 (1994)
   PUBMED   7931292
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            BC027984.1, L40027.1, D63424.1 and BC051865.2.
            On Jul 1, 2004 this sequence version replaced gi:11995473.
            
            Summary: This gene encodes a multifunctional Ser/Thr protein kinase
            that is implicated in the control of several regulatory proteins
            including glycogen synthase, and transcription factors, such as
            JUN. It also plays a role in the WNT and PI3K signaling pathways,
            as well as regulates the production of beta-amyloid peptides
            associated with Alzheimer's disease. [provided by RefSeq, Oct
            2011].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC051865.2, BC027984.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025081, ERS025082 [ECO:0000350]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1438              BC027984.1         20-1457
            1439-1440           L40027.1           1434-1435
            1441-2182           D63424.1           1413-2154
            2183-2189           BC027984.1         2202-2208
            2190-2200           BC051865.2         2179-2189
FEATURES             Location/Qualifiers
     source          1..2200
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="19"
                     /map="19q13.2"
     gene            1..2200
                     /gene="GSK3A"
                     /note="glycogen synthase kinase 3 alpha"
                     /db_xref="GeneID:2931"
                     /db_xref="HGNC:4616"
                     /db_xref="MIM:606784"
     exon            1..402
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     CDS             120..1571
                     /gene="GSK3A"
                     /EC_number="2.7.11.1"
                     /EC_number="2.7.11.26"
                     /note="GSK-3 alpha; serine/threonine-protein kinase GSK3A"
                     /codon_start=1
                     /product="glycogen synthase kinase-3 alpha"
                     /protein_id="NP_063937.2"
                     /db_xref="GI:49574532"
                     /db_xref="CCDS:CCDS12599.1"
                     /db_xref="GeneID:2931"
                     /db_xref="HGNC:4616"
                     /db_xref="MIM:606784"
                     /translation="
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGVGASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYTDIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGVCHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLPPLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLTNSS
"
     misc_feature    123..125
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylserine; propagated from
                     UniProtKB/Swiss-Prot (P49840.2); acetylation site"
     misc_feature    123..125
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P49840.2); phosphorylation site"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by PKB/AKT1; propagated from
                     UniProtKB/Swiss-Prot (P49840.2); phosphorylation site"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01498"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01499"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01501"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01502"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:03382"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:06151"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:06349"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /citation=[8]
                     /db_xref="HPRD:01261"
     misc_feature    180..182
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:04264"
     misc_feature    333..335
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P49840.2); phosphorylation site"
     misc_feature    348..350
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P49840.2); phosphorylation site"
     misc_feature    408..410
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (P49840.2); phosphorylation site"
     misc_feature    474..1328
                     /gene="GSK3A"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl09925"
                     /db_xref="CDD:213116"
     misc_feature    474..1328
                     /gene="GSK3A"
                     /note="Protein kinase domain; Region: Pkinase; pfam00069"
                     /db_xref="CDD:200973"
     misc_feature    order(492..506,516..518,555..557,561..563,636..638,
                     702..713,729..731,735..737,849..851,855..857,861..866,
                     870..872,906..908,915..917,960..971)
                     /gene="GSK3A"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(492..506,516..518,555..557,561..563,636..638,
                     702..713,729..731,849..851,855..857,861..866,870..872,
                     906..908)
                     /gene="GSK3A"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    order(504..506,729..731,735..737,849..851,855..857,
                     861..863,915..917,960..971)
                     /gene="GSK3A"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    order(903..923,960..971)
                     /gene="GSK3A"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    951..953
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:06002"
     misc_feature    954..956
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    954..956
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
     misc_feature    954..956
                     /gene="GSK3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:06002"
     exon            403..590
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     STS             414..564
                     /gene="GSK3A"
                     /standard_name="D19S688E"
                     /db_xref="UniSTS:150587"
     exon            591..674
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     exon            675..785
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     STS             753..815
                     /gene="GSK3A"
                     /standard_name="MARC_17709-17710:1031755211:1"
                     /db_xref="UniSTS:268383"
     exon            786..916
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     exon            917..1023
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     exon            1024..1121
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     STS             1122..1355
                     /gene="GSK3A"
                     /standard_name="RH11670"
                     /db_xref="UniSTS:39033"
     exon            1122..1217
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     STS             1213..1355
                     /gene="GSK3A"
                     /standard_name="SHGC-32066"
                     /db_xref="UniSTS:39032"
     exon            1218..1404
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     exon            1405..1497
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     exon            1498..2179
                     /gene="GSK3A"
                     /inference="alignment:Splign:1.39.8"
     variation       1835
                     /gene="GSK3A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054311"
     STS             1914..1999
                     /gene="GSK3A"
                     /standard_name="D19S656E"
                     /db_xref="UniSTS:150570"
     variation       2041
                     /gene="GSK3A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054318"
     variation       2097
                     /gene="GSK3A"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1802524"
     variation       2111
                     /gene="GSK3A"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054370"
     variation       2121
                     /gene="GSK3A"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1054371"
ORIGIN      
cccaagccagagcggcgcggcctggaagaggccagggcccgggggaggcggcggcagcggcggcggctggggcagcccgggcagcccgagccccgcagcctgggcctgtgctcggcgccatgagcggcggcgggccttcgggaggcggccctgggggctcgggcagggcgcggactagctcgttcgcggagcccggcggcggaggcggaggaggcggcggcggccccggaggctcggcctccggcccaggcggcaccggcggcggaaaggcatctgtcggggccatgggtgggggcgtcggggcctcgagctccgggggtggacccggcggcagcggcggaggaggcagcggaggccccggcgcaggcactagcttcccgccgcccggggtgaagctgggccgtgacagcgggaaggtgaccacagtcgtagccactctaggccaaggcccagagcgctcccaagaagtggcttacacggacatcaaagtgattggcaatggctcatttggggtcgtgtaccaggcacggctggcagagaccagggaactagtcgccatcaagaaggttctccaggacaagaggttcaagaaccgagagctgcagatcatgcgtaagctggaccactgcaatattgtgaggctgagatactttttctactccagtggcgagaagaaagacgagctttacctaaatctggtgctggaatatgtgcccgagacagtgtaccgggtggcccgccacttcaccaaggccaagttgaccatccctatcctctatgtcaaggtgtacatgtaccagctcttccgcagcttggcctacatccactcccagggcgtgtgtcaccgcgacatcaagccccagaacctgctggtggaccctgacactgctgtcctcaagctctgcgattttggcagtgcaaagcagttggtccgaggggagcccaatgtctcctacatctgttctcgctactaccgggccccagagctcatctttggagccactgattacacctcatccatcgatgtttggtcagctggctgtgtactggcagagctcctcttgggccagcccatcttccctggggacagtggggtggaccagctggtggagatcatcaaggtgctgggaacaccaacccgggaacaaatccgagagatgaaccccaactacacggagttcaagttccctcagattaaagctcacccctggacaaaggtgttcaaatctcgaacgccgccagaggccatcgcgctctgctctagcctgctggagtacaccccatcctcaaggctctccccactagaggcctgtgcgcacagcttctttgatgaactgcgatgtctgggaacccagctgcctaacaaccgcccacttccccctctcttcaacttcagtgctggtgaactctccatccaaccgtctctcaacgccattctcatccctcctcacttgaggtccccagcgggcactaccaccctcaccccgtcctcacaagctttaactgagactccgaccagctcagactggcagtcgaccgatgccacacctaccctcactaactcctcctgagggccccaccaagcacccttccacttccatctgggagccccaagaggggctgggaaggggggccatagcccatcaagctcctgccctggctgggcccctagactagagggcagaggtaaatgagtccctgtccccacctccagtccctccctcaccagcctcacccctgtggtgggctttttaagaggattttaactggttgtggggagggaagagaaggacagggtgttggggggatgaggacctcctacccccttggccccctcccctcccccagacctccacctcctccagaccccctcccctcctgtgtcccttgtaaatagaaccagcccagcccgtctcctcttcccttccctggcccccgggtgtaaatagattgttataatttttttcttaaagaaaacgtcgattcgcaccgtccaacctggccccgcccctcctacagctgtaactcccctcctgtcctctgcccccaaggtctactccctcctcaccccaccctggagggccaggggagtggagagagctcctgatgtcttagtttccacagtaaggtttgcctgtgtacagacctccgttcaataaattattggcatgaaaacctgaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:2931 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
            GeneID:2931 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:2931 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
            GeneID:2931 -> Molecular function: GO:0034236 [protein kinase A catalytic subunit binding] evidence: IPI
            GeneID:2931 -> Molecular function: GO:0050321 [tau-protein kinase activity] evidence: TAS
            GeneID:2931 -> Biological process: GO:0003073 [regulation of systemic arterial blood pressure] evidence: ISS
            GeneID:2931 -> Biological process: GO:0003214 [cardiac left ventricle morphogenesis] evidence: ISS
            GeneID:2931 -> Biological process: GO:0005977 [glycogen metabolic process] evidence: IEA
            GeneID:2931 -> Biological process: GO:0006349 [regulation of gene expression by genetic imprinting] evidence: IEA
            GeneID:2931 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
            GeneID:2931 -> Biological process: GO:0006987 [activation of signaling protein activity involved in unfolded protein response] evidence: TAS
            GeneID:2931 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
            GeneID:2931 -> Biological process: GO:0007399 [nervous system development] evidence: IEA
            GeneID:2931 -> Biological process: GO:0008286 [insulin receptor signaling pathway] evidence: ISS
            GeneID:2931 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
            GeneID:2931 -> Biological process: GO:0010800 [positive regulation of peptidyl-threonine phosphorylation] evidence: IEA
            GeneID:2931 -> Biological process: GO:0010905 [negative regulation of UDP-glucose catabolic process] evidence: IC
            GeneID:2931 -> Biological process: GO:0016055 [Wnt receptor signaling pathway] evidence: IEA
            GeneID:2931 -> Biological process: GO:0016477 [cell migration] evidence: IEA
            GeneID:2931 -> Biological process: GO:0030819 [positive regulation of cAMP biosynthetic process] evidence: ISS
            GeneID:2931 -> Biological process: GO:0030968 [endoplasmic reticulum unfolded protein response] evidence: TAS
            GeneID:2931 -> Biological process: GO:0032007 [negative regulation of TOR signaling cascade] evidence: ISS
            GeneID:2931 -> Biological process: GO:0032869 [cellular response to insulin stimulus] evidence: IMP
            GeneID:2931 -> Biological process: GO:0033138 [positive regulation of peptidyl-serine phosphorylation] evidence: IEA
            GeneID:2931 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
            GeneID:2931 -> Biological process: GO:0044027 [hypermethylation of CpG island] evidence: IEA
            GeneID:2931 -> Biological process: GO:0044267 [cellular protein metabolic process] evidence: TAS
            GeneID:2931 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
            GeneID:2931 -> Biological process: GO:0045719 [negative regulation of glycogen biosynthetic process] evidence: TAS
            GeneID:2931 -> Biological process: GO:0045732 [positive regulation of protein catabolic process] evidence: NAS
            GeneID:2931 -> Biological process: GO:0045823 [positive regulation of heart contraction] evidence: ISS
            GeneID:2931 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
            GeneID:2931 -> Biological process: GO:0046325 [negative regulation of glucose import] evidence: IMP
            GeneID:2931 -> Biological process: GO:0046627 [negative regulation of insulin receptor signaling pathway] evidence: IMP
            GeneID:2931 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
            GeneID:2931 -> Biological process: GO:0048015 [phosphatidylinositol-mediated signaling] evidence: TAS
            GeneID:2931 -> Biological process: GO:0051348 [negative regulation of transferase activity] evidence: IMP
            GeneID:2931 -> Biological process: GO:0061052 [negative regulation of cell growth involved in cardiac muscle cell development] evidence: ISS
            GeneID:2931 -> Biological process: GO:0071285 [cellular response to lithium ion] evidence: IEA
            GeneID:2931 -> Biological process: GO:0071407 [cellular response to organic cyclic compound] evidence: IEA
            GeneID:2931 -> Biological process: GO:0071879 [positive regulation of adrenergic receptor signaling pathway] evidence: ISS
            GeneID:2931 -> Biological process: GO:0090090 [negative regulation of canonical Wnt receptor signaling pathway] evidence: TAS
            GeneID:2931 -> Biological process: GO:2000077 [negative regulation of type B pancreatic cell development] evidence: TAS
            GeneID:2931 -> Biological process: GO:2000466 [negative regulation of glycogen (starch) synthase activity] evidence: TAS
            GeneID:2931 -> Biological process: GO:2000467 [positive regulation of glycogen (starch) synthase activity] evidence: ISS
            GeneID:2931 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
            GeneID:2931 -> Cellular component: GO:0030877 [beta-catenin destruction complex] evidence: NAS
            GeneID:2931 -> Cellular component: GO:0030877 [beta-catenin destruction complex] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_063937 -> EC 2.7.11.1
            NP_063937 -> EC 2.7.11.26

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.