Home |
Help |
Advanced search
2024-04-23 19:12:14, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_018955 971 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens ubiquitin B (UBB), mRNA.
ACCESSION NM_018955
VERSION NM_018955.2 GI:22538474
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 971)
AUTHORS Chadwick,L., Gentle,L., Strachan,J. and Layfield,R.
TITLE Review: unchained maladie - a reassessment of the role of Ubb(+1)
-capped polyubiquitin chains in Alzheimer's disease
JOURNAL Neuropathol. Appl. Neurobiol. 38 (2), 118-131 (2012)
PUBMED 22082077
REMARK GeneRIF: age-dependent accumulation of Ubb(+1) , and how Ubb(+1)
-mediated proteasome inhibition may contribute to Alzheimer's
disease. [review]
Review article
REFERENCE 2 (bases 1 to 971)
AUTHORS Haas,A.L. and Leach,C.A.
TITLE A baker's dozen of ubiquitin
JOURNAL Cell Biochem. Biophys. 60 (1-2), 1 (2011)
PUBMED 21544573
REMARK GeneRIF: Studies indicate that biomedical research on ubiquitin
moves into translational research and drug discovery.
REFERENCE 3 (bases 1 to 971)
AUTHORS Kessler,B.M. and Edelmann,M.J.
TITLE PTMs in conversation: activity and function of deubiquitinating
enzymes regulated via post-translational modifications
JOURNAL Cell Biochem. Biophys. 60 (1-2), 21-38 (2011)
PUBMED 21480003
REMARK GeneRIF: Studies indicate that DUBs recycle ubiquitin by processing
polyubiquitin chains to generate free ubiquitin, and can be
regulated by ubiquitination or phosphorylation.
Review article
REFERENCE 4 (bases 1 to 971)
AUTHORS Dalrymple,M.B., Jaeger,W.C., Eidne,K.A. and Pfleger,K.D.
TITLE Temporal profiling of orexin receptor-arrestin-ubiquitin complexes
reveals differences between receptor subtypes
JOURNAL J. Biol. Chem. 286 (19), 16726-16733 (2011)
PUBMED 21378163
REMARK GeneRIF: analysis of orexin receptor 1 and 2 -arrestin-ubiquitin
complexes
REFERENCE 5 (bases 1 to 971)
AUTHORS van Tijn,P., Hobo,B., Verhage,M.C., Oitzl,M.S., van Leeuwen,F.W.
and Fischer,D.F.
TITLE Alzheimer-associated mutant ubiquitin impairs spatial reference
memory
JOURNAL Physiol. Behav. 102 (2), 193-200 (2011)
PUBMED 21059367
REMARK GeneRIF: The results of this study demonstrated that the UBB
mutation caused the subtle defect in spatial reference memory
formation, caused by a decrease in forebrain proteasome activity.
REFERENCE 6 (bases 1 to 971)
AUTHORS Adams,S.M., Sharp,M.G., Walker,R.A., Brammar,W.J. and Varley,J.M.
TITLE Differential expression of translation-associated genes in benign
and malignant human breast tumours
JOURNAL Br. J. Cancer 65 (1), 65-71 (1992)
PUBMED 1370760
REFERENCE 7 (bases 1 to 971)
AUTHORS Pancre,V., Pierce,R.J., Fournier,F., Mehtali,M., Delanoye,A.,
Capron,A. and Auriault,C.
TITLE Effect of ubiquitin on platelet functions: possible identity with
platelet activity suppressive lymphokine (PASL)
JOURNAL Eur. J. Immunol. 21 (11), 2735-2741 (1991)
PUBMED 1657614
REFERENCE 8 (bases 1 to 971)
AUTHORS Baker,R.T. and Board,P.G.
TITLE The human ubiquitin-52 amino acid fusion protein gene shares
several structural features with mammalian ribosomal protein genes
JOURNAL Nucleic Acids Res. 19 (5), 1035-1040 (1991)
PUBMED 1850507
REFERENCE 9 (bases 1 to 971)
AUTHORS Webb,G.C., Baker,R.T., Fagan,K. and Board,P.G.
TITLE Localization of the human UbB polyubiquitin gene to chromosome band
17p11.1-17p12
JOURNAL Am. J. Hum. Genet. 46 (2), 308-315 (1990)
PUBMED 2154095
REFERENCE 10 (bases 1 to 971)
AUTHORS Schlesinger,D.H. and Goldstein,G.
TITLE Hybrid troponin reconstituted from vertebrate and arthropod
subunits
JOURNAL Nature 255 (5507), 423-424 (1975)
PUBMED 124018
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from X04803.2 and BC000379.2.
This sequence is a reference standard in the RefSeqGene project.
On Aug 29, 2002 this sequence version replaced gi:11024713.
Summary: This gene encodes ubiquitin, one of the most conserved
proteins known. Ubiquitin is required for ATP-dependent,
nonlysosomal intracellular protein degradation of abnormal proteins
and normal proteins with a rapid turnover. Ubiquitin is covalently
bound to proteins to be degraded, and presumably labels these
proteins for degradation. Ubiquitin also binds to histone H2A in
actively transcribed regions but does not cause histone H2A
degradation, suggesting that ubiquitin is also involved in
regulation of gene expression. This gene consists of three direct
repeats of the ubiquitin coding sequence with no spacer sequence.
Consequently, the protein is expressed as a polyubiquitin precursor
with a final amino acid after the last repeat. Aberrant form of
this protein has been noticed in patients with Alzheimer's and Down
syndrome. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC000379.2, BM927587.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: full length.
FEATURES Location/Qualifiers
source 1..971
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="17"
/map="17p12-p11.2"
gene 1..971
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="ubiquitin B"
/db_xref="GeneID:7314"
/db_xref="HGNC:12463"
/db_xref="HPRD:06771"
/db_xref="MIM:191339"
exon 1..132
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/inference="alignment:Splign:1.39.8"
misc_feature 1
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="5'-most transcription initiation site has not been
determined"
variation 30
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="g"
/replace="t"
/db_xref="dbSNP:144918437"
variation 33
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:368947993"
misc_feature 45
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="transcription initiation site"
variation 55
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="g"
/db_xref="dbSNP:3744326"
variation 107
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="g"
/replace="t"
/db_xref="dbSNP:75327805"
variation 116
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="g"
/db_xref="dbSNP:7208009"
misc_feature 127..129
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="upstream in-frame stop codon"
exon 133..971
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/inference="alignment:Splign:1.39.8"
CDS 139..828
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="polyubiquitin B; Polyubiquitin-B"
/codon_start=1
/product="polyubiquitin-B precursor"
/protein_id="NP_061828.1"
/db_xref="GI:11024714"
/db_xref="CCDS:CCDS11177.1"
/db_xref="GeneID:7314"
/db_xref="HGNC:12463"
/db_xref="HPRD:06771"
/db_xref="MIM:191339"
/translation="
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC
"
misc_feature 139..366
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
mat_peptide 139..366
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/product="polyubiquitin-B"
misc_feature 139..354
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:214563"
misc_feature order(154..168,256..258,262..264,268..270,277..285,
340..342,346..366)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(154..156,160..168,253..255,259..264,334..336,
340..342,346..366)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(154..156,160..162,268..270,274..285,340..342,
346..348,352..354,364..366)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 340..342
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/experiment="experimental evidence, no additional details
recorded"
/note="Essential for function; propagated from
UniProtKB/Swiss-Prot (P0CG47.1); other site"
misc_feature 367..594
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
mat_peptide 367..594
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/product="polyubiquitin-B"
misc_feature 367..582
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:214563"
misc_feature order(382..396,484..486,490..492,496..498,505..513,
568..570,574..594)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(382..384,388..396,481..483,487..492,562..564,
568..570,574..594)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(382..384,388..390,496..498,502..513,568..570,
574..576,580..582,592..594)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
misc_feature 595..822
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubiquitin; Region: Ubiquitin; cd01803"
/db_xref="CDD:176398"
mat_peptide 595..822
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/product="polyubiquitin-B"
misc_feature 595..810
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubiquitin homologues; Region: UBQ; smart00213"
/db_xref="CDD:214563"
misc_feature order(610..624,712..714,718..720,724..726,733..741,
796..798,802..822)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - E2 interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(610..612,616..624,709..711,715..720,790..792,
796..798,802..822)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - UCH interaction site; other site"
/db_xref="CDD:176398"
misc_feature order(610..612,616..618,724..726,730..741,796..798,
802..804,808..810,820..822)
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/note="Ubq - CUE interaction site; other site"
/db_xref="CDD:176398"
variation 160
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:11550545"
variation 183
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="g"
/replace="t"
/db_xref="dbSNP:17026960"
variation 195
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:151174232"
STS 202..602
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="39082591"
/db_xref="UniSTS:498050"
STS 202..374
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="39082591"
/db_xref="UniSTS:498050"
variation 225..226
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace=""
/replace="t"
/db_xref="dbSNP:34227126"
variation 246
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:16962978"
variation 249
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:16962981"
STS 255..813
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="D2S1561E"
/db_xref="UniSTS:150646"
STS 255..585
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="D2S1561E"
/db_xref="UniSTS:150646"
STS 255..357
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="D2S1561E"
/db_xref="UniSTS:150646"
variation 267
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:373239807"
variation 281
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="t"
/db_xref="dbSNP:139133663"
variation 286
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:149735634"
variation 288
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:143121650"
variation 294
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:17849300"
variation 297
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:145568298"
variation 298
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:147392000"
variation 303
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="g"
/replace="t"
/db_xref="dbSNP:148876590"
variation 321
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:9908960"
variation 333
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="g"
/db_xref="dbSNP:146449749"
variation 345
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:377358152"
STS 372..647
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="AA555564"
/db_xref="UniSTS:206909"
variation 393
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:370706400"
variation 408
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:16962973"
STS 430..602
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="39082591"
/db_xref="UniSTS:498050"
variation 447
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:377487692"
variation 459
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:17052364"
variation 461
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:3202129"
variation 465
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:1060199"
STS 483..813
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="D2S1561E"
/db_xref="UniSTS:150646"
STS 483..585
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="D2S1561E"
/db_xref="UniSTS:150646"
variation 528
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:1060079"
variation 564
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="c"
/db_xref="dbSNP:148184773"
variation 579
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:370468040"
STS 600..647
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="AA555564"
/db_xref="UniSTS:206909"
variation 621
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="c"
/db_xref="dbSNP:141581067"
STS 630..770
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="RH1659"
/db_xref="UniSTS:62659"
STS 711..813
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/standard_name="D2S1561E"
/db_xref="UniSTS:150646"
variation 714
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:138298095"
variation 717
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:376813261"
variation 723
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:149612063"
variation 731
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:11550548"
variation 753
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:201208945"
variation 772
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:1065103"
variation 777
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:147281408"
variation 783
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:201547246"
variation 828..829
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace=""
/replace="t"
/db_xref="dbSNP:368225113"
variation 839
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:374182250"
variation 844
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="t"
/db_xref="dbSNP:116070441"
variation 847
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:7218030"
variation 852
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:374935774"
variation 872
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:1061290"
variation 876
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="g"
/db_xref="dbSNP:369275749"
variation 903
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="t"
/db_xref="dbSNP:14261"
variation 917
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="g"
/replace="t"
/db_xref="dbSNP:14660"
polyA_signal 949..954
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
variation 969
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="c"
/replace="g"
/db_xref="dbSNP:185174661"
variation 970
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:113339371"
polyA_site 971
/gene="UBB"
/gene_synonym="RPS27A; UBA52; UBC"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
cactcgttgcataaatttgcgctccgccagcccggagcatttaggggcggttggctttgttgggtgagcttgtttgtgtccctgtgggtggacgtggttggtgattggcaggatcctggtatccgctaacaggtcaaaatgcagatcttcgtgaaaacccttaccggcaagaccatcacccttgaggtggagcccagtgacaccatcgaaaatgtgaaggccaagatccaggataaggaaggcattccccccgaccagcagaggctcatctttgcaggcaagcagctggaagatggccgtactctttctgactacaacatccagaaggagtcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttcgtgaagaccctgaccggcaagaccatcaccctggaagtggagcccagtgacaccatcgaaaatgtgaaggccaagatccaggataaagaaggcatccctcccgaccagcagaggctcatctttgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaggagtcgaccctgcacctggtcctgcgtctgagaggtggtatgcagatcttcgtgaagaccctgaccggcaagaccatcactctggaggtggagcccagtgacaccatcgaaaatgtgaaggccaagatccaagataaagaaggcatcccccccgaccagcagaggctcatctttgcaggcaagcagctggaagatggccgcactctttctgactacaacatccagaaagagtcgaccctgcacctggtcctgcgcctgaggggtggctgttaattcttcagtcatggcattcgcagtgcccagtgatggcattactctgcactatagccatttgccccaacttaagtttagaaattacaagtttcagtaatagctgaacctgttcaaaatgttaataaaggtttcgttgcatggta
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7314 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:7314 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:7314 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:7314 -> Biological process: GO:0000187 [activation of MAPK activity] evidence: TAS
GeneID:7314 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:7314 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:7314 -> Biological process: GO:0002224 [toll-like receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:7314 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:7314 -> Biological process: GO:0002755 [MyD88-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0002756 [MyD88-independent toll-like receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0006281 [DNA repair] evidence: TAS
GeneID:7314 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: TAS
GeneID:7314 -> Biological process: GO:0006367 [transcription initiation from RNA polymerase II promoter] evidence: TAS
GeneID:7314 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:7314 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:7314 -> Biological process: GO:0007173 [epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0007179 [transforming growth factor beta receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0007219 [Notch signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0007220 [Notch receptor processing] evidence: TAS
GeneID:7314 -> Biological process: GO:0007249 [I-kappaB kinase/NF-kappaB cascade] evidence: TAS
GeneID:7314 -> Biological process: GO:0007254 [JNK cascade] evidence: TAS
GeneID:7314 -> Biological process: GO:0008543 [fibroblast growth factor receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:7314 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:7314 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS
GeneID:7314 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:7314 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:7314 -> Biological process: GO:0016197 [endosomal transport] evidence: TAS
GeneID:7314 -> Biological process: GO:0019067 [viral assembly, maturation, egress, and release] evidence: TAS
GeneID:7314 -> Biological process: GO:0019068 [virion assembly] evidence: TAS
GeneID:7314 -> Biological process: GO:0019082 [viral protein processing] evidence: TAS
GeneID:7314 -> Biological process: GO:0019221 [cytokine-mediated signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0030512 [negative regulation of transforming growth factor beta receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:7314 -> Biological process: GO:0032479 [regulation of type I interferon production] evidence: TAS
GeneID:7314 -> Biological process: GO:0032480 [negative regulation of type I interferon production] evidence: TAS
GeneID:7314 -> Biological process: GO:0032481 [positive regulation of type I interferon production] evidence: TAS
GeneID:7314 -> Biological process: GO:0034134 [toll-like receptor 2 signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0034138 [toll-like receptor 3 signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0034142 [toll-like receptor 4 signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0034146 [toll-like receptor 5 signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0034162 [toll-like receptor 9 signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0034166 [toll-like receptor 10 signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0034220 [ion transmembrane transport] evidence: TAS
GeneID:7314 -> Biological process: GO:0035666 [TRIF-dependent toll-like receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0035872 [nucleotide-binding domain, leucine rich repeat containing receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0038095 [Fc-epsilon receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0038123 [toll-like receptor TLR1:TLR2 signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0038124 [toll-like receptor TLR6:TLR2 signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0042059 [negative regulation of epidermal growth factor receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:7314 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:7314 -> Biological process: GO:0043065 [positive regulation of apoptotic process] evidence: TAS
GeneID:7314 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:7314 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: TAS
GeneID:7314 -> Biological process: GO:0045087 [innate immune response] evidence: TAS
GeneID:7314 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:7314 -> Biological process: GO:0046788 [egress of virus within host cell] evidence: TAS
GeneID:7314 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0050852 [T cell receptor signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0051092 [positive regulation of NF-kappaB transcription factor activity] evidence: TAS
GeneID:7314 -> Biological process: GO:0051403 [stress-activated MAPK cascade] evidence: TAS
GeneID:7314 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:7314 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:7314 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:7314 -> Biological process: GO:0055085 [transmembrane transport] evidence: TAS
GeneID:7314 -> Biological process: GO:0061418 [regulation of transcription from RNA polymerase II promoter in response to hypoxia] evidence: TAS
GeneID:7314 -> Biological process: GO:0070423 [nucleotide-binding oligomerization domain containing signaling pathway] evidence: TAS
GeneID:7314 -> Biological process: GO:0071456 [cellular response to hypoxia] evidence: TAS
GeneID:7314 -> Biological process: GO:0097190 [apoptotic signaling pathway] evidence: TAS
GeneID:7314 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:7314 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:7314 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
GeneID:7314 -> Cellular component: GO:0010008 [endosome membrane] evidence: TAS
GeneID:7314 -> Cellular component: GO:0030666 [endocytic vesicle membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.