Home |
Help |
Advanced search
2024-04-23 18:39:06, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_018456 1024 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens ELL associated factor 2 (EAF2), mRNA.
ACCESSION NM_018456
VERSION NM_018456.4 GI:41350199
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1024)
AUTHORS Savas,S., Azorsa,D.O., Jarjanazi,H., Ibrahim-Zada,I.,
Gonzales,I.M., Arora,S., Henderson,M.C., Choi,Y.H., Briollais,L.,
Ozcelik,H. and Tuzmen,S.
TITLE NCI60 cancer cell line panel data and RNAi analysis help identify
EAF2 as a modulator of simvastatin and lovastatin response in
HCT-116 cells
JOURNAL PLoS ONE 6 (4), E18306 (2011)
PUBMED 21483694
REMARK GeneRIF: the role of the EAF2 in response to simvastatin and
lovastatin in HCT-116 colon cancer cells
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1024)
AUTHORS Su,F., Pascal,L.E., Xiao,W. and Wang,Z.
TITLE Tumor suppressor U19/EAF2 regulates thrombospondin-1 expression via
p53
JOURNAL Oncogene 29 (3), 421-431 (2010)
PUBMED 19826414
REMARK GeneRIF: Data suggest that U19/EAF2 regulates the expression of
TSP-1 via blocking p53 repression of the TSP-1 promoter.
REFERENCE 3 (bases 1 to 1024)
AUTHORS Wan,X., Ji,W., Mei,X., Zhou,J., Liu,J.X., Fang,C. and Xiao,W.
TITLE Negative feedback regulation of Wnt4 signaling by EAF1 and EAF2/U19
JOURNAL PLoS ONE 5 (2), E9118 (2010)
PUBMED 20161747
REMARK GeneRIF: Findings provide the first convincing line of evidence
that EAF and Wnt4 form an auto-regulatory negative feedback loop in
vivo.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1024)
AUTHORS Jiang,F., Ai,J., Xiao,W. and Wang,Z.
TITLE FB1, an E2A fusion partner in childhood leukemia, interacts with
U19/EAF2 and inhibits its transcriptional activity
JOURNAL Cancer Lett. 253 (2), 265-272 (2007)
PUBMED 17395368
REMARK GeneRIF: FB1 is an important binding partner and a functional
regulator of U19/EAF2, EAF1, and/or ELL.
REFERENCE 5 (bases 1 to 1024)
AUTHORS Xiao,W., Jiang,F. and Wang,Z.
TITLE ELL binding regulates U19/Eaf2 intracellular localization,
stability, and transactivation
JOURNAL Prostate 66 (1), 1-12 (2006)
PUBMED 16114057
REMARK GeneRIF: ELL may be an important factor required for U19/Eaf2
function because U19/Eaf2 nuclear localization and transactivation
activity are essential for its function as a transcription factor.
REFERENCE 6 (bases 1 to 1024)
AUTHORS Kong,S.E., Banks,C.A., Shilatifard,A., Conaway,J.W. and
Conaway,R.C.
TITLE ELL-associated factors 1 and 2 are positive regulators of RNA
polymerase II elongation factor ELL
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 102 (29), 10094-10098 (2005)
PUBMED 16006523
REMARK GeneRIF: ELL-associated factors 1 and 2 are positive regulators of
RNA polymerase II elongation factor ELL.
REFERENCE 7 (bases 1 to 1024)
AUTHORS Xiao,W., Zhang,Q., Jiang,F., Pins,M., Kozlowski,J.M. and Wang,Z.
TITLE Suppression of prostate tumor growth by U19, a novel
testosterone-regulated apoptosis inducer
JOURNAL Cancer Res. 63 (15), 4698-4704 (2003)
PUBMED 12907652
REMARK GeneRIF: U19 is growth inhibitory and tumor suppressive and that
the disruption of androgen-dependent growth inhibition via U19
down-regulation is commonly associated with prostate cancer
progression.
REFERENCE 8 (bases 1 to 1024)
AUTHORS Saso,K., Ito,T., Natori,S. and Sekimizu,K.
TITLE Identification of a novel tissue-specific transcriptional activator
FESTA as a protein that interacts with the transcription elongation
factor S-II
JOURNAL J. Biochem. 133 (4), 493-500 (2003)
PUBMED 12761297
REFERENCE 9 (bases 1 to 1024)
AUTHORS Simone,F., Luo,R.T., Polak,P.E., Kaberlein,J.J. and Thirman,M.J.
TITLE ELL-associated factor 2 (EAF2), a functional homolog of EAF1 with
alternative ELL binding properties
JOURNAL Blood 101 (6), 2355-2362 (2003)
PUBMED 12446457
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BU941228.1 and AY049020.1.
On Jan 27, 2004 this sequence version replaced gi:34147688.
##Evidence-Data-START##
Transcript exon combination :: AY049020.1, BC014209.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025082, ERS025084 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-351 BU941228.1 4-354
352-1024 AY049020.1 324-996
FEATURES Location/Qualifiers
source 1..1024
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="3"
/map="3q13.33"
gene 1..1024
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/note="ELL associated factor 2"
/db_xref="GeneID:55840"
/db_xref="HGNC:23115"
/db_xref="HPRD:09634"
/db_xref="MIM:607659"
exon 1..205
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/inference="alignment:Splign:1.39.8"
variation 22
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="g"
/db_xref="dbSNP:137919021"
variation 23
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="t"
/db_xref="dbSNP:79879117"
variation 58
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:368353923"
variation 60
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="g"
/replace="t"
/db_xref="dbSNP:200075766"
variation 69
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:201683243"
misc_feature 76..78
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/note="upstream in-frame stop codon"
CDS 100..882
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/note="testosterone regulated apoptosis inducer and tumor
suppressor; testosterone-regulated apoptosis inducer and
tumor suppressor protein"
/codon_start=1
/product="ELL-associated factor 2"
/protein_id="NP_060926.2"
/db_xref="GI:21361796"
/db_xref="CCDS:CCDS3006.1"
/db_xref="GeneID:55840"
/db_xref="HGNC:23115"
/db_xref="HPRD:09634"
/db_xref="MIM:607659"
/translation="
MNSAAGFSHLDRRERVLKLGESFEKQPRCAFHTVRYDFKPASIDTSSEGYLEVGEGEQVTITLPNIEGSTPPVTVFKGSKKPYLKECILIINHDTGECRLEKLSSNITVKKTRVEGSSKIQYRKEQQQQQMWNSARTPNLVKHSPSEDKMSPASPIDDIERELKAEASLMDQMSSCDSSSDSKSSSSSSSEDSSSDSEDEDCKSSTSDTGNCVSGHPTMTQYRIPDIDASHNRFRDNSGLLMNTLRNDLQLSESGSDSDD
"
misc_feature 139..447
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/note="RNA polymerase II transcription elongation factor;
Region: EAF; pfam09816"
/db_xref="CDD:192393"
misc_feature 148..411
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q96CJ1.1);
Region: Necessary for interaction with ELL"
misc_feature 550..552
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q96CJ1.1); phosphorylation site"
misc_feature 559..561
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q96CJ1.1); phosphorylation site"
misc_feature 628..879
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q96CJ1.1);
Region: Necessary for transactivation activity"
misc_feature 835..879
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q96CJ1.1);
Region: Necessary for interaction with TCEA1 and
transactivation activity (By similarity)"
variation 114
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:113829843"
variation 141
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:368458597"
variation 176
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:151186324"
exon 206..300
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/inference="alignment:Splign:1.39.8"
variation 225
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:140410765"
variation 240
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:376595504"
variation 261
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:9884018"
exon 301..437
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/inference="alignment:Splign:1.39.8"
variation 303
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:137954962"
variation 311
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:143406125"
variation 335
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="g"
/db_xref="dbSNP:200203978"
variation 361
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:376098445"
variation 363
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:370918421"
variation 367
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:199728332"
variation 373
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="c"
/db_xref="dbSNP:181890306"
variation 377
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="t"
/db_xref="dbSNP:372839868"
variation 394
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:377108596"
variation 408
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="g"
/db_xref="dbSNP:368625178"
exon 438..583
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/inference="alignment:Splign:1.39.8"
variation 467
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:200869698"
variation 502
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="g"
/replace="t"
/db_xref="dbSNP:377482100"
variation 516
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:371539988"
variation 524
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="c"
/db_xref="dbSNP:374533737"
variation 527
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:367693877"
variation 533
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="c"
/db_xref="dbSNP:371684639"
variation 566
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:150707706"
variation 571
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:191848489"
variation 577
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:138459007"
exon 584..835
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/inference="alignment:Splign:1.39.8"
variation 619
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="t"
/db_xref="dbSNP:149263421"
variation 620
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:369929009"
variation 623
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:202181046"
variation 641
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:144356897"
variation 684
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:199994792"
variation 719
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:200859609"
variation 729
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:375955486"
variation 741
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:369018167"
variation 762
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="g"
/db_xref="dbSNP:372997631"
variation 795
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:148765156"
variation 801
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:376558625"
variation 802
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="t"
/db_xref="dbSNP:370593056"
variation 807
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="c"
/replace="g"
/db_xref="dbSNP:139363943"
variation 816
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="c"
/db_xref="dbSNP:115221306"
exon 836..1020
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/inference="alignment:Splign:1.39.8"
variation 861
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:375184515"
variation 866
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:139737449"
variation 868
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:369719657"
variation 876
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="g"
/replace="t"
/db_xref="dbSNP:373626345"
variation 918
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:375931372"
variation 920
/gene="EAF2"
/gene_synonym="BM040; TRAITS; U19"
/replace="a"
/replace="g"
/db_xref="dbSNP:370035902"
ORIGIN
gggtgacttggctggcgggatcaagtgcagctgcttcaggctgaggtggcagatagtgagcgctggtggcggagttaaagtcaaagcaggagagtaattatgaatagcgcagcgggattctcacacctagaccgtcgcgagcgggttctcaagttaggggagagtttcgagaagcagccgcgctgcgccttccacactgtgcgctatgacttcaaacctgcttctattgacacttcttctgaaggataccttgaggttggtgaaggtgaacaggtgaccataactctgccaaatatagaaggttcaactccaccagtaactgttttcaaaggttcaaaaaaaccttacttaaaagaatgcattttgattattaaccatgatactggagaatgtcggctagaaaaactcagcagcaacatcactgtaaaaaaaacaagagttgaaggaagcagtaaaattcagtatcgtaaagaacaacagcaacaacaaatgtggaattcagccaggactcccaatcttgtaaaacattctccatctgaagataagatgtccccagcatctccaatagatgatatcgaaagagaactgaaggcagaagctagtctaatggaccagatgagtagttgtgatagttcatcagattccaaaagttcatcatcttcaagtagtgaggatagttctagtgactcagaagatgaagattgcaaatcctctacttctgatacagggaattgtgtctcaggacatcctaccatgacacagtacaggattcctgatatagatgccagtcataatagatttcgagacaacagtggccttctgatgaatactttaagaaatgatttgcagctgagtgaatcaggaagtgacagtgatgactgaagaaatatttagctataaataaaaatttatacagcatgtataatttattttgtattaacaataaaaattcctaagactgagggaaatatgtcttaacttttgatgataaaagaaattaaatttgattcagaaatttcaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:55840 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:55840 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
GeneID:55840 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:55840 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA
GeneID:55840 -> Biological process: GO:0030308 [negative regulation of cell growth] evidence: IEA
GeneID:55840 -> Biological process: GO:0045893 [positive regulation of transcription, DNA-dependent] evidence: IEA
GeneID:55840 -> Biological process: GO:0060770 [negative regulation of epithelial cell proliferation involved in prostate gland development] evidence: IEA
GeneID:55840 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:55840 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
GeneID:55840 -> Cellular component: GO:0016607 [nuclear speck] evidence: IEA
GeneID:55840 -> Cellular component: GO:0032783 [ELL-EAF complex] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.