GGRNA Home | Help | Advanced search

2020-10-24 06:08:25, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_018271               1985 bp    mRNA    linear   PRI 20-APR-2013
DEFINITION  Homo sapiens threonine synthase-like 2 (S. cerevisiae) (THNSL2),
            transcript variant 1, mRNA.
ACCESSION   NM_018271
VERSION     NM_018271.4  GI:347658947
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1985)
  AUTHORS   Fox,C.S., Liu,Y., White,C.C., Feitosa,M., Smith,A.V.,
            Heard-Costa,N., Lohman,K., Johnson,A.D., Foster,M.C.,
            Greenawalt,D.M., Griffin,P., Ding,J., Newman,A.B., Tylavsky,F.,
            Miljkovic,I., Kritchevsky,S.B., Launer,L., Garcia,M.,
            Eiriksdottir,G., Carr,J.J., Gudnason,V., Harris,T.B., Cupples,L.A.
            and Borecki,I.B.
  CONSRTM   GIANT Consortium; MAGIC Consortium; GLGC Consortium
  TITLE     Genome-wide association for abdominal subcutaneous and visceral
            adipose reveals a novel locus for visceral fat in women
  JOURNAL   PLoS Genet. 8 (5), E1002695 (2012)
   PUBMED   22589738
REFERENCE   2  (bases 1 to 1985)
  AUTHORS   Mason,C.C., Hanson,R.L., Ossowski,V., Bian,L., Baier,L.J.,
            Krakoff,J. and Bogardus,C.
  TITLE     Bimodal distribution of RNA expression levels in human skeletal
            muscle tissue
  JOURNAL   BMC Genomics 12, 98 (2011)
   PUBMED   21299892
  REMARK    GeneRIF: THNSL2 was found to have bimodal expression in human
            skeletal muscle tissue.
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1985)
  AUTHORS   Rifas,L. and Weitzmann,M.N.
  TITLE     A novel T cell cytokine, secreted osteoclastogenic factor of
            activated T cells, induces osteoclast formation in a
            RANKL-independent manner
  JOURNAL   Arthritis Rheum. 60 (11), 3324-3335 (2009)
   PUBMED   19877052
  REMARK    GeneRIF: A cytokine named SOFAT (secreted osteoclastogenic factor
            of activated T cells) can induce osteoblastic IL-6 production and
            osteoclast formation in the absence of osteoblasts or RANKL. It is
            insensitive to RANKL inhibitor osteoprotegerin.
REFERENCE   4  (bases 1 to 1985)
  AUTHORS   Donini,S., Percudani,R., Credali,A., Montanini,B., Sartori,A. and
            Peracchi,A.
  TITLE     A threonine synthase homolog from a mammalian genome
  JOURNAL   Biochem. Biophys. Res. Commun. 350 (4), 922-928 (2006)
   PUBMED   17034760
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA196694.1, AC092836.4,
            BC035315.1 and AI313402.1.
            On Sep 24, 2011 this sequence version replaced gi:149193322.
            
            Summary: This gene encodes a threonine synthase-like protein. A
            similar enzyme in mouse can catalyze the degradation of
            O-phospho-homoserine to a-ketobutyrate, phosphate, and ammonia.
            This protein also has phospho-lyase activity on both gamma and beta
            phosphorylated substrates. In mouse an alternatively spliced form
            of this protein has been shown to act as a cytokine and can induce
            the production of the inflammatory cytokine IL6 in osteoblasts.
            Alternate splicing results in multiple transcript variants.
            [provided by RefSeq, Sep 2011].
            
            Transcript Variant: This variant (1) encodes the longest isoform
            (1).
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK095303.1, BC035315.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-133               DA196694.1         332-464
            134-134             AC092836.4         106457-106457
            135-169             DA196694.1         466-500
            170-1797            BC035315.1         1-1628
            1798-1971           BC035315.1         1630-1803
            1972-1985           AI313402.1         1-14                c
FEATURES             Location/Qualifiers
     source          1..1985
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p11.2"
     gene            1..1985
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="threonine synthase-like 2 (S. cerevisiae)"
                     /db_xref="GeneID:55258"
                     /db_xref="HGNC:25602"
                     /db_xref="MIM:611261"
     exon            1..235
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     CDS             13..1467
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /EC_number="4.2.3.-"
                     /note="isoform 1 is encoded by transcript variant 1;
                     secreted osteoclastogenic factor of activated T cells"
                     /codon_start=1
                     /product="threonine synthase-like 2 isoform 1"
                     /protein_id="NP_060741.3"
                     /db_xref="GI:149193323"
                     /db_xref="CCDS:CCDS2002.2"
                     /db_xref="GeneID:55258"
                     /db_xref="HGNC:25602"
                     /db_xref="MIM:611261"
                     /translation="
MWYVSTRGVAPRVNFEGALFSGYAPDGGLFMPEELPQLDRGTLCQWSTLSYPGLVKELCALFIGSELLPKDELNDLIDRAFSRFRHREVVHLSRLRNGLNVLELWHGVTYAFKDLSLSCTTQFLQYFLEKREKHVTVVVGTSGDTGSAAIESVQGAKNMDIIVLLPKGHCTKIQELQMTTVLKQNVHVFGVEGNSDELDEPIKTVFADVAFVKKHNLMSLNSINWSRVLVQMAHHFFAYFQCTPSLDTHPLPLVEVVVPTGAAGNLAAGYIAQKIGLPIRLVVAVNRNDIIHRTVQQGDFSLSEAVKSTLASAMDIQVPYNMERVFWLLSGSDSQVTRALMEQFERTQSVNLPKELHSKLSEAVTSVSVSDEAITQTMGRCWDENQYLLCPHSAVAVNYHYQQIDRQQPSTPRCCLAPASAAKFPEAVLAAGLTPETPAEIVALEHKETRCTLMRRGDNWMLMLRDTIEDLSRQWRSHALNTSQ
"
     misc_feature    13..1371
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="Threonine synthase [Amino acid transport and
                     metabolism]; Region: ThrC; COG0498"
                     /db_xref="CDD:30844"
     misc_feature    16..1404
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="Threonine synthase catalyzes the final step of
                     threonine biosynthesis. The conversion of
                     O-phosphohomoserine into threonine and inorganic phosphate
                     is pyridoxal 5'-phosphate dependent. The Thr-synth_1 CD
                     includes members from higher plants, cyanobacteria;
                     Region: Thr-synth_2; cd01560"
                     /db_xref="CDD:107203"
     misc_feature    order(349..351,793..798,1264..1266)
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107203"
     misc_feature    349..351
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107203"
     variation       36
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367785526"
     variation       44
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374311669"
     variation       47
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139953850"
     variation       77
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369820777"
     variation       80
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151033743"
     variation       89
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373551702"
     variation       90
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:114858196"
     variation       134
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4129190"
     variation       141
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370944153"
     variation       143
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146704484"
     variation       152
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143468353"
     variation       154
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142011143"
     variation       175
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147509382"
     variation       226
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199500112"
     exon            236..430
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       243
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371211298"
     variation       244
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:34841493"
     variation       248
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376146285"
     variation       251
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142704703"
     variation       266
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376220295"
     variation       292
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143431033"
     variation       315
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199609866"
     variation       331
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145369179"
     variation       334
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35541720"
     variation       351
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149024211"
     variation       373
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143018511"
     variation       376
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143306537"
     variation       401
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111555319"
     variation       407
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:137996561"
     variation       414
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149479181"
     variation       415
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192084638"
     exon            431..583
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       441
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:75522866"
     variation       481
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375276075"
     variation       494
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:139757275"
     variation       535
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144678899"
     variation       544
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:372908030"
     variation       550
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374885568"
     variation       551
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369239668"
     variation       568
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371602854"
     exon            584..814
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       606
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146726960"
     variation       623
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:34136143"
     variation       627
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150966723"
     variation       633
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:116861191"
     variation       634
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369508046"
     variation       740
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34250376"
     variation       753
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149200089"
     variation       799
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370334316"
     variation       802
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141464891"
     exon            815..963
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       826
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371763302"
     variation       831
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73949231"
     variation       851
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375483620"
     variation       855
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35051888"
     variation       858
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148640386"
     variation       859
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147776956"
     variation       871
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368558816"
     variation       882
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145009340"
     variation       891
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200402354"
     variation       908
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375964297"
     variation       933
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141094872"
     exon            964..1089
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       970
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138871561"
     variation       982
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17855905"
     variation       983
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:199612488"
     variation       985
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376687469"
     variation       993
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:36125522"
     variation       1024
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369834788"
     variation       1076
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374321239"
     exon            1090..1241
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       1111
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368972090"
     variation       1151
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377730165"
     variation       1170
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371434708"
     variation       1186
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200804670"
     variation       1200
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374796449"
     variation       1201
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144146961"
     exon            1242..1981
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /inference="alignment:Splign:1.39.8"
     variation       1264
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76963547"
     variation       1281
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377665314"
     variation       1327
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200685654"
     variation       1328
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375608550"
     variation       1341
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368148454"
     variation       1348
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200077966"
     variation       1350
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370502681"
     variation       1360
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143087335"
     variation       1376
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151161854"
     variation       1405
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367584313"
     variation       1406
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372281823"
     variation       1457
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141207786"
     variation       1467
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3210976"
     variation       1526
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78594831"
     variation       1533
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146940055"
     STS             1662..1966
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /standard_name="D2S2610"
                     /db_xref="UniSTS:37791"
     variation       1748
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3183983"
     variation       1793..1794
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:3215271"
     STS             1818..1952
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /standard_name="RH47580"
                     /db_xref="UniSTS:63546"
     variation       1824
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115884283"
     variation       1852
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127735"
     variation       1896
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127736"
     variation       1903
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1127738"
     polyA_signal    1949..1954
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
     polyA_site      1981
                     /gene="THNSL2"
                     /gene_synonym="SOFAT; THS2; TSH2"
ORIGIN      
gcctccaggatcatgtggtatgtcagcaccaggggcgtagccccacgggtcaactttgagggggccctcttctctggctatgcacctgacgggggcctctttatgcctgaagagctcccacagttggacagagggaccctgtgccagtggagcacactctcctatcctggcctggtgaaggagctgtgtgccctcttcattggctctgagctccttccaaaagatgaattaaatgatctgatcgaccgagccttcagcagattccgtcacagagaagtggtccatctgtccaggttgaggaatgggctgaacgtgttggagctgtggcatggcgtcacatatgcatttaaggacctgtccctgtcctgcacaacacagttcctgcagtacttcctggagaagagggagaagcacgtcactgtggttgtaggaacatctggggacacaggaagtgctgccattgagagtgttcaaggggcaaagaacatggacattatcgttctgctgcccaaaggtcactgcacaaagattcaggagctccagatgacaacggtgctgaagcagaacgtacatgtgtttggagtggagggaaacagcgatgagctcgatgagccgatcaagactgtgtttgccgatgtggcttttgtcaagaagcacaatctgatgagcctgaattcgatcaactggtcccgggtcctggtgcagatggcccatcacttctttgcttacttccagtgtacgccatccttggacacacatcccctacccctggtggaggtggttgtgccaacaggggctgccggtaaccttgcagctgggtacattgctcaaaagataggcctgcccatccgtctggtcgtggcagtgaaccgcaatgacatcatccacaggactgtccagcagggagacttctctctctctgaggctgttaaatcaaccttggcatcagctatggacattcaggtgccctacaacatggagagggtgttctggctgctctctggctctgacagccaggtgacaagagccctcatggagcagtttgaaaggacccaaagtgtgaatctgcccaaggaactgcacagcaagctttcagaggcagtgacatccgtgtcagtgtcggatgaagccatcacccagaccatgggccgctgctgggatgagaaccagtacttgctgtgcccccactcagcggtggccgtgaactaccattaccagcagatagacaggcagcagcccagcactccccggtgctgcctcgcccctgcctctgcagccaagttcccggaagctgtcctggctgctggcctgacccctgagactcccgcggagatcgtagccctggagcacaaggagacacgctgcaccctgatgcggagaggtgacaactggatgctgatgcttcgggacaccattgaggaccttagccgacagtggaggagtcatgccctcaacacctcccagtagcctggctggaggtggctttctttaggcttcagatcccaggaagatgcaccttctgagctgccttgtgcaccctccccattaagcgtaggttaggaggtttccgggaggctgctcagctggatctggagccagctggctttgctccgttccctggctagtctgtgcctggtcaccagggaggctgagtgaggggctgtgaacagttgccggaagcaccccctccctccccggcccgtgcagcagtgtctgagctgtagtgaaagtttcagggcctgcaaaagaagaggcttgggcacaggactgaccatggctccaggggtttaggaccccagacctgtgaaggtgggagcagctcaccaccttcacgcaggctttgtatgttctctgagccttagttgattttggcccccaaaccaaatccaaaggttctggcccaccttgtcagaggcttccaccctgctcacatgttgggaatccctggaataaaatgcttgttcagtgtgatggagcggcaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:55258 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
            GeneID:55258 -> Molecular function: GO:0005125 [cytokine activity] evidence: IEA
            GeneID:55258 -> Molecular function: GO:0016829 [lyase activity] evidence: IEA
            GeneID:55258 -> Molecular function: GO:0030170 [pyridoxal phosphate binding] evidence: ISS
            GeneID:55258 -> Molecular function: GO:0070905 [serine binding] evidence: ISS
            GeneID:55258 -> Biological process: GO:0008150 [biological_process] evidence: ND
            GeneID:55258 -> Biological process: GO:0009071 [serine family amino acid catabolic process] evidence: ISS
            GeneID:55258 -> Biological process: GO:0016311 [dephosphorylation] evidence: ISS
            GeneID:55258 -> Biological process: GO:0046360 [2-oxobutyrate biosynthetic process] evidence: ISS
            GeneID:55258 -> Cellular component: GO:0005575 [cellular_component] evidence: ND
            GeneID:55258 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_060741 -> EC 4.2.3.-

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.