Home |
Help |
Advanced search
2024-04-24 05:07:57, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_016640 1686 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens mitochondrial ribosomal protein S30 (MRPS30), mRNA.
ACCESSION NM_016640
VERSION NM_016640.3 GI:58331149
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1686)
AUTHORS Li,J., Humphreys,K., Heikkinen,T., Aittomaki,K., Blomqvist,C.,
Pharoah,P.D., Dunning,A.M., Ahmed,S., Hooning,M.J., Martens,J.W.,
van den Ouweland,A.M., Alfredsson,L., Palotie,A.,
Peltonen-Palotie,L., Irwanto,A., Low,H.Q., Teoh,G.H.,
Thalamuthu,A., Easton,D.F., Nevanlinna,H., Liu,J., Czene,K. and
Hall,P.
TITLE A combined analysis of genome-wide association studies in breast
cancer
JOURNAL Breast Cancer Res. Treat. 126 (3), 717-727 (2011)
PUBMED 20872241
REFERENCE 2 (bases 1 to 1686)
AUTHORS Flachsbart,F., Franke,A., Kleindorp,R., Caliebe,A., Blanche,H.,
Schreiber,S. and Nebel,A.
TITLE Investigation of genetic susceptibility factors for human longevity
- a targeted nonsynonymous SNP study
JOURNAL Mutat. Res. 694 (1-2), 13-19 (2010)
PUBMED 20800603
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 3 (bases 1 to 1686)
AUTHORS Hendrickson,S.L., Lautenberger,J.A., Chinn,L.W., Malasky,M.,
Sezgin,E., Kingsley,L.A., Goedert,J.J., Kirk,G.D., Gomperts,E.D.,
Buchbinder,S.P., Troyer,J.L. and O'Brien,S.J.
TITLE Genetic variants in nuclear-encoded mitochondrial genes influence
AIDS progression
JOURNAL PLoS ONE 5 (9), E12862 (2010)
PUBMED 20877624
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1686)
AUTHORS Zheng,W., Cai,Q., Signorello,L.B., Long,J., Hargreaves,M.K.,
Deming,S.L., Li,G., Li,C., Cui,Y. and Blot,W.J.
TITLE Evaluation of 11 breast cancer susceptibility loci in
African-American women
JOURNAL Cancer Epidemiol. Biomarkers Prev. 18 (10), 2761-2764 (2009)
PUBMED 19789366
REMARK GeneRIF: Observational study of gene-disease association and
gene-gene interaction. (HuGE Navigator)
REFERENCE 5 (bases 1 to 1686)
AUTHORS Zhang,Z. and Gerstein,M.
TITLE Identification and characterization of over 100 mitochondrial
ribosomal protein pseudogenes in the human genome
JOURNAL Genomics 81 (5), 468-480 (2003)
PUBMED 12706105
REFERENCE 6 (bases 1 to 1686)
AUTHORS Kenmochi,N., Suzuki,T., Uechi,T., Magoori,M., Kuniba,M., Higa,S.,
Watanabe,K. and Tanaka,T.
TITLE The human mitochondrial ribosomal protein genes: mapping of 54
genes to the chromosomes and implications for human disorders
JOURNAL Genomics 77 (1-2), 65-70 (2001)
PUBMED 11543634
REFERENCE 7 (bases 1 to 1686)
AUTHORS Cavdar Koc,E., Burkhart,W., Blackburn,K., Moseley,A. and
Spremulli,L.L.
TITLE The small subunit of the mammalian mitochondrial ribosome.
Identification of the full complement of ribosomal proteins present
JOURNAL J. Biol. Chem. 276 (22), 19363-19374 (2001)
PUBMED 11279123
REFERENCE 8 (bases 1 to 1686)
AUTHORS Carim,L., Sumoy,L., Nadal,M., Estivill,X. and Escarceller,M.
TITLE Cloning, expression, and mapping of PDCD9, the human homolog of
Gallus gallus pro-apoptotic protein p52
JOURNAL Cytogenet. Cell Genet. 87 (1-2), 85-88 (1999)
PUBMED 10640817
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AF146192.2, BC007735.2 and
BU676154.1.
On Jan 29, 2005 this sequence version replaced gi:16950598.
Summary: Mammalian mitochondrial ribosomal proteins are encoded by
nuclear genes and help in protein synthesis within the
mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a
small 28S subunit and a large 39S subunit. They have an estimated
75% protein to rRNA composition compared to prokaryotic ribosomes,
where this ratio is reversed. Another difference between mammalian
mitoribosomes and prokaryotic ribosomes is that the latter contain
a 5S rRNA. Among different species, the proteins comprising the
mitoribosome differ greatly in sequence, and sometimes in
biochemical properties, which prevents easy recognition by sequence
homology. This gene encodes a 28S subunit protein that is similar
to the chicken pro-apoptotic protein p52. Transcript variants using
alternative promoters or polyA sites have been mentioned in the
literature but the complete description of these sequences is not
available. [provided by RefSeq, Jul 2008].
##Evidence-Data-START##
Transcript exon combination :: AF146192.2, BC007735.2 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
##RefSeq-Attributes-START##
gene product(s) localized to mito. :: reported by MitoCarta
##RefSeq-Attributes-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-135 AF146192.2 1-135
136-335 BC007735.2 113-312
336-1467 AF146192.2 336-1467
1468-1686 BU676154.1 1-219 c
FEATURES Location/Qualifiers
source 1..1686
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="5"
/map="5q11"
gene 1..1686
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/note="mitochondrial ribosomal protein S30"
/db_xref="GeneID:10884"
/db_xref="HGNC:8769"
/db_xref="HPRD:17597"
/db_xref="MIM:611991"
exon 1..639
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/inference="alignment:Splign:1.39.8"
misc_feature 9..11
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/note="upstream in-frame stop codon"
variation 13
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/db_xref="dbSNP:376218736"
variation 33
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:370303744"
CDS 39..1358
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/note="programmed cell death 9"
/codon_start=1
/product="28S ribosomal protein S30, mitochondrial"
/protein_id="NP_057724.2"
/db_xref="GI:58331150"
/db_xref="CCDS:CCDS3951.1"
/db_xref="GeneID:10884"
/db_xref="HGNC:8769"
/db_xref="HPRD:17597"
/db_xref="MIM:611991"
/translation="
MAAARCWRPLLRGPRLSLHTAANAAATATETTCQDVAATPVARYPPIVASMTADSKAARLRRIERWQATVHAAESVDEKLRILTKMQFMKYMVYPQTFALNADRWYQYFTKTVFLSGLPPPPAEPEPEPEPEPEPALDLAALRAVACDCLLQEHFYLRRRRRVHRYEESEVISLPFLDQLVSTLVGLLSPHNPALAAAALDYRCPVHFYWVRGEEIIPRGHRRGRIDDLRYQIDDKPNNQIRISKQLAEFVPLDYSVPIEIPTIKCKPDKLPLFKRQYENHIFVGSKTADPCCYGHTQFHLLPDKLRRERLLRQNCADQIEVVFRANAIASLFAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRPKEEKSQLLEN
"
misc_feature 39..1325
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/note="Mitochondrial 28S ribosomal protein S30 (PDCD9);
Region: PDCD9; pfam07147"
/db_xref="CDD:148640"
variation 40
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:141755487"
variation 46
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:150142880"
variation 47
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:138618175"
variation 72
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/db_xref="dbSNP:112901974"
variation 75
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:373668154"
variation 101
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:147448507"
variation 106
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:11558840"
variation 131
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:181330521"
variation 136
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:3747479"
variation 168
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:370412803"
variation 203
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:62366782"
variation 221
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:139909496"
variation 251
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="g"
/db_xref="dbSNP:201694963"
variation 261
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:199713309"
variation 276
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/db_xref="dbSNP:373854638"
variation 284
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/db_xref="dbSNP:3747480"
variation 287
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:368809928"
variation 306
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:11558841"
variation 312
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:200609148"
variation 343
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:35601455"
variation 347
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:144310922"
variation 382
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="t"
/db_xref="dbSNP:145293565"
variation 414
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:201514017"
variation 420
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:61754779"
variation 425
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:372322665"
variation 428
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:142383960"
variation 437
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:375428957"
variation 440
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:367803496"
variation 453
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="g"
/db_xref="dbSNP:150879289"
variation 470
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="g"
/db_xref="dbSNP:139744880"
variation 471
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:371769536"
variation 475
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:376523824"
variation 482
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:369376366"
variation 484
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:144542965"
variation 499
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:370300488"
variation 506
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:373661125"
variation 513
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:190648137"
variation 515
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:367609552"
variation 522
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="g"
/db_xref="dbSNP:146658127"
variation 549
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:140258486"
variation 551
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="g"
/db_xref="dbSNP:144036768"
variation 560
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:371666495"
variation 598
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:144926318"
exon 640..785
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/inference="alignment:Splign:1.39.8"
variation 666
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:374868414"
variation 694
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:368376102"
variation 736
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:72756207"
variation 747
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:200967272"
variation 758
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:372442166"
variation 762
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:201364888"
variation 770
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:143116127"
exon 786..891
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/inference="alignment:Splign:1.39.8"
variation 813
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:148250980"
variation 823
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:377254751"
variation 864
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:61753790"
exon 892..1068
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/inference="alignment:Splign:1.39.8"
variation 919
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:147017456"
variation 945
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/db_xref="dbSNP:138293397"
variation 952
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:75089600"
variation 966
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:34522103"
variation 971
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="t"
/db_xref="dbSNP:139675934"
variation 984
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:373592441"
variation 1002
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:7737306"
variation 1008
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:201011555"
variation 1023
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:138758815"
variation 1026
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:149383515"
variation 1031
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/db_xref="dbSNP:377019282"
exon 1069..1670
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/inference="alignment:Splign:1.39.8"
variation 1127
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:144776967"
variation 1140
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:61754777"
variation 1160
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:367987660"
variation 1164
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="t"
/db_xref="dbSNP:201798833"
variation 1203
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="t"
/db_xref="dbSNP:61754778"
variation 1206
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="t"
/db_xref="dbSNP:144501088"
STS 1216..1364
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/standard_name="RH78328"
/db_xref="UniSTS:90224"
STS 1221..1388
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/standard_name="SHGC-186"
/db_xref="UniSTS:54895"
variation 1225
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="c"
/replace="g"
/db_xref="dbSNP:188372674"
variation 1231
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:372106101"
variation 1235
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:145225329"
variation 1248
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:376396555"
variation 1250
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:146164829"
variation 1273
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:368141641"
variation 1313
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:370467602"
variation 1318
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="t"
/db_xref="dbSNP:141351340"
variation 1365
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:78086852"
variation 1386
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:10076253"
variation 1392
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="t"
/db_xref="dbSNP:373753150"
variation 1412
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/db_xref="dbSNP:145091314"
variation 1415
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="t"
/db_xref="dbSNP:180681837"
variation 1436
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="c"
/db_xref="dbSNP:79210252"
polyA_signal 1441..1446
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
variation 1459..1460
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace=""
/replace="t"
/db_xref="dbSNP:56840325"
polyA_site 1467
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/experiment="experimental evidence, no additional details
recorded"
polyA_site 1469
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/experiment="experimental evidence, no additional details
recorded"
variation 1598
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="g"
/replace="t"
/db_xref="dbSNP:111467139"
polyA_signal 1649..1654
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
variation 1652
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
/replace="a"
/replace="g"
/db_xref="dbSNP:74613309"
polyA_site 1670
/gene="MRPS30"
/gene_synonym="MRP-S30; PAP; PDCD9; S30mt"
ORIGIN
gcttaagttgacctctgggtccggaatcgcgggcaaagatggcggcggccaggtgttggaggcctttgctacgcggtccgaggctttcattgcacaccgcggctaatgccgccgccacggctacagaaacgacctgccaagacgtcgcggcgacccccgtcgcgcggtacccgccgattgtggcctccatgacagccgacagcaaagctgcacggctgcggcggatcgagcgctggcaggcgacggtgcacgctgcggagtcggtagacgagaagctgcgaatcctcaccaagatgcagtttatgaagtacatggtttacccgcagaccttcgcgctgaatgccgaccgctggtaccagtacttcaccaagaccgtgttcctgtcgggtctgccgccgcccccagcggagcccgagcccgagcccgaacccgaacctgaacctgcgctggacctcgcggcgctgcgtgcggtcgcctgcgactgcctgctgcaggagcacttctacctgcggcgcaggcggcgcgtgcaccgttacgaggagagcgaggtcatatctttgcccttcctggatcagctggtgtcaaccctcgtgggcctcctcagcccacacaacccggccctggccgctgccgccctcgattatagatgcccagttcatttttactgggtgcgtggtgaagaaattattcctcgtggtcatcgaagaggtcgaattgatgacttgcgataccagatagatgataaaccaaacaaccagattcgaatatccaagcaactcgcagagtttgtgccattggattattctgttcctatagaaatccccactataaaatgtaaaccagacaaacttccattattcaaacggcagtatgaaaaccacatatttgttggctcaaaaactgcagatccttgctgttacggtcacacccagtttcatctgttacctgacaaattaagaagggaaaggcttttgagacaaaactgtgctgatcagatagaagttgtttttagagctaatgctattgcaagcctttttgcttggactggagcacaagctatgtatcaaggattctggagtgaagcagatgttactcgaccttttgtctcccaggctgtgatcacagatggaaaatacttttcctttttctgctaccagctaaatactttggcactgactacacaagctgatcaaaataaccctcgtaaaaatatatgttggggtacacaaagtaagcctctttatgaaacaattgaggataatgatgtgaaaggttttaatgatgatgttctacttcagatagttcactttctactgaatagaccaaaagaagaaaaatcacagctgttggaaaactgaaaaagcatatttgattgagaactgtgggaatatttaaattttactgaaggaacaataatgatgagatttgtaactgtcaactattaaatacattgatttttgagacaaatatttcttatgtcaacctgttattagatctcttactctgctcaaattcatcactgaaagatttaattttagttaccttttgttgatttaaaaataattgcatttgtatattgctaactgataagacaaattgagttattgagctattaaatgcacattttaatataaatgcagaaatcccaaataaaatgctaacatactgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10884 -> Molecular function: GO:0003735 [structural constituent of ribosome] evidence: IEA
GeneID:10884 -> Biological process: GO:0006412 [translation] evidence: IEA
GeneID:10884 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:10884 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA
GeneID:10884 -> Cellular component: GO:0005840 [ribosome] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.