Home |
Help |
Advanced search
2024-04-27 07:56:44, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_016639 1048 bp mRNA linear PRI 24-JUN-2013
DEFINITION Homo sapiens tumor necrosis factor receptor superfamily, member 12A
(TNFRSF12A), mRNA.
ACCESSION NM_016639
VERSION NM_016639.2 GI:187828666
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1048)
AUTHORS Pellegrini,M., Willen,L., Perroud,M., Krushinskie,D., Strauch,K.,
Cuervo,H., Day,E.S., Schneider,P. and Zheng,T.S.
TITLE Structure of the extracellular domains of human and Xenopus Fn14:
implications in the evolution of TWEAK and Fn14 interactions
JOURNAL FEBS J. 280 (8), 1818-1829 (2013)
PUBMED 23438059
REMARK GeneRIF: TWEAK binds to hFn14 by surface plasmon resonance (View
interaction) xeFn14 binds to TWEAK by enzyme linked immunosorbent
assay
REFERENCE 2 (bases 1 to 1048)
AUTHORS Moreno,J.A., Sastre,C., Madrigal-Matute,J., Munoz-Garcia,B.,
Ortega,L., Burkly,L.C., Egido,J., Martin-Ventura,J.L. and
Blanco-Colio,L.M.
TITLE HMGB1 expression and secretion are increased via TWEAK-Fn14
interaction in atherosclerotic plaques and cultured monocytes
JOURNAL Arterioscler. Thromb. Vasc. Biol. 33 (3), 612-620 (2013)
PUBMED 23288170
REMARK GeneRIF: TWEAK/Fn14 can regulate expression and secretion of HMGB1
in monocytes/macrophages, participating in the inflammatory
response associated with atherosclerotic plaque development.
REFERENCE 3 (bases 1 to 1048)
AUTHORS Chapman,M.S., Wu,L., Amatucci,A., Ho,S.N. and Michaelson,J.S.
TITLE TWEAK signals through JAK-STAT to induce tumor cell apoptosis
JOURNAL Cytokine 61 (1), 210-217 (2013)
PUBMED 23107828
REMARK GeneRIF: we show that TWEAK/Fn14 can signal through the JAK-STAT
pathway to induce interferon-beta, and that the ability of TWEAK to
induce tumor cell apoptosis is mediated by JAK-STAT signaling.
REFERENCE 4 (bases 1 to 1048)
AUTHORS Gaudineau,B., Fougere,M., Guaddachi,F., Lemoine,F., de la Grange,P.
and Jauliac,S.
TITLE Lipocalin 2, the TNF-like receptor TWEAKR and its ligand TWEAK act
downstream of NFAT1 to regulate breast cancer cell invasion
JOURNAL J. Cell. Sci. 125 (PT 19), 4475-4486 (2012)
PUBMED 22767506
REMARK GeneRIF: LCN2 and TWEAKR-TWEAK as crucial downstream effectors of
NFAT1 that regulate breast cancer cell motility and invasive
capacity.
REFERENCE 5 (bases 1 to 1048)
AUTHORS Lu,J., Szeto,C.C., Tam,L.S., Lai,F.M., Li,E.K., Chow,K.M., Li,P.K.
and Kwan,B.C.
TITLE Relationship of intrarenal gene expression and the histological
class of lupus nephritis -- a study on repeat renal biopsy
JOURNAL J. Rheumatol. 39 (10), 1942-1947 (2012)
PUBMED 22896023
REMARK GeneRIF: Glomerular Fn14 and tubulointerstitial TWEAK and IP-10
expression appeared to have consistent changes in relation to the
histological class of lupus nephritis and correlated with the
histological activity index.
REFERENCE 6 (bases 1 to 1048)
AUTHORS Nakayama,M., Ishidoh,K., Kojima,Y., Harada,N., Kominami,E.,
Okumura,K. and Yagita,H.
TITLE Fibroblast growth factor-inducible 14 mediates multiple pathways of
TWEAK-induced cell death
JOURNAL J. Immunol. 170 (1), 341-348 (2003)
PUBMED 12496418
REMARK GeneRIF: FN14 is the sole mediator of the multiple pathways of
TWEAK-induced cell death in all TWEAK-sensitive tumor cell lines.
REFERENCE 7 (bases 1 to 1048)
AUTHORS Harada,N., Nakayama,M., Nakano,H., Fukuchi,Y., Yagita,H. and
Okumura,K.
TITLE Pro-inflammatory effect of TWEAK/Fn14 interaction on human
umbilical vein endothelial cells
JOURNAL Biochem. Biophys. Res. Commun. 299 (3), 488-493 (2002)
PUBMED 12445828
REMARK GeneRIF: These results indicated that TWEAK could induce
pro-inflammatory reactions via fibroblast growth factor-inducible
14 (Fn14)on human umbilical vein endothelial cells.
REFERENCE 8 (bases 1 to 1048)
AUTHORS Wiley,S.R., Cassiano,L., Lofton,T., Davis-Smith,T., Winkles,J.A.,
Lindner,V., Liu,H., Daniel,T.O., Smith,C.A. and Fanslow,W.C.
TITLE A novel TNF receptor family member binds TWEAK and is implicated in
angiogenesis
JOURNAL Immunity 15 (5), 837-846 (2001)
PUBMED 11728344
REFERENCE 9 (bases 1 to 1048)
AUTHORS Feng,S.L., Guo,Y., Factor,V.M., Thorgeirsson,S.S., Bell,D.W.,
Testa,J.R., Peifley,K.A. and Winkles,J.A.
TITLE The Fn14 immediate-early response gene is induced during liver
regeneration and highly expressed in both human and murine
hepatocellular carcinomas
JOURNAL Am. J. Pathol. 156 (4), 1253-1261 (2000)
PUBMED 10751351
REFERENCE 10 (bases 1 to 1048)
AUTHORS Meighan-Mantha,R.L., Hsu,D.K., Guo,Y., Brown,S.A., Feng,S.L.,
Peifley,K.A., Alberts,G.F., Copeland,N.G., Gilbert,D.J.,
Jenkins,N.A., Richards,C.M. and Winkles,J.A.
TITLE The mitogen-inducible Fn14 gene encodes a type I transmembrane
protein that modulates fibroblast adhesion and migration
JOURNAL J. Biol. Chem. 274 (46), 33166-33176 (1999)
PUBMED 10551889
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BM842283.1 and BC002718.2.
On May 9, 2008 this sequence version replaced gi:7706185.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC002718.2, BQ278863.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-29 BM842283.1 8-36
30-1048 BC002718.2 1-1019
FEATURES Location/Qualifiers
source 1..1048
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="16"
/map="16p13.3"
gene 1..1048
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/note="tumor necrosis factor receptor superfamily, member
12A"
/db_xref="GeneID:51330"
/db_xref="HGNC:18152"
/db_xref="HPRD:05801"
/db_xref="MIM:605914"
exon 1..180
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/inference="alignment:Splign:1.39.8"
variation 71
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:374188616"
CDS 87..476
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/note="type I transmembrane protein Fn14; tweak-receptor;
FGF-inducible 14; fibroblast growth factor-inducible
immediate-early response protein 14"
/codon_start=1
/product="tumor necrosis factor receptor superfamily
member 12A precursor"
/protein_id="NP_057723.1"
/db_xref="GI:7706186"
/db_xref="CCDS:CCDS10489.1"
/db_xref="GeneID:51330"
/db_xref="HGNC:18152"
/db_xref="HPRD:05801"
/db_xref="MIM:605914"
/translation="
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
"
sig_peptide 87..167
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
misc_feature 162..473
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/note="Tumour necrosis factor receptor stn_TNFRSF12A_TNFR
domain; Region: stn_TNFRSF12A; pfam12191"
/db_xref="CDD:152626"
mat_peptide 168..473
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/product="Tumor necrosis factor receptor superfamily
member 12A"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NP84.1)"
misc_feature 192..287
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NP84.1);
Region: TNFR-Cys, atypical"
misc_feature 327..389
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NP84.1);
transmembrane region"
variation 92..93
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace=""
/replace="c"
/db_xref="dbSNP:370139607"
variation 94
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="g"
/db_xref="dbSNP:201779448"
exon 181..285
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/inference="alignment:Splign:1.39.8"
variation 194
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="t"
/db_xref="dbSNP:370109719"
variation 211
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:199793810"
variation 243
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:145869202"
variation 259
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:376963832"
variation 263
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:2232797"
exon 286..420
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/inference="alignment:Splign:1.39.8"
variation 304
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="t"
/db_xref="dbSNP:138228648"
variation 306
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="g"
/db_xref="dbSNP:373195860"
variation 307
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:181233313"
variation 312
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:149551322"
variation 326
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="t"
/db_xref="dbSNP:138754924"
variation 336
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:369391888"
variation 356
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="t"
/db_xref="dbSNP:372932532"
variation 357
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:144286329"
variation 359
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:200551574"
variation 364
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="g"
/db_xref="dbSNP:199603705"
variation 384
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:148756180"
exon 421..1033
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/inference="alignment:Splign:1.39.8"
variation 441
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:141463046"
variation 444
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:201879993"
variation 465
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="t"
/db_xref="dbSNP:200684664"
variation 470
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="c"
/db_xref="dbSNP:2232799"
variation 521
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="t"
/db_xref="dbSNP:376412855"
variation 527
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:376479483"
variation 601
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:58148974"
variation 613
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:13209"
variation 638..639
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace=""
/replace="g"
/db_xref="dbSNP:34787333"
variation 694
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="t"
/db_xref="dbSNP:185286477"
variation 725..728
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace=""
/replace="gact"
/db_xref="dbSNP:373188175"
variation 732
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="g"
/db_xref="dbSNP:3760086"
variation 740
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="g"
/db_xref="dbSNP:28595195"
variation 776
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:1044326"
variation 788..789
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="g"
/db_xref="dbSNP:11558765"
variation 821
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="g"
/replace="t"
/db_xref="dbSNP:190588947"
STS 919..998
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/standard_name="STS-T56712"
/db_xref="UniSTS:33040"
variation 958
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:3760087"
variation 993
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="a"
/replace="g"
/db_xref="dbSNP:114883839"
variation 999..1000
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace=""
/replace="g"
/db_xref="dbSNP:34461776"
variation 1017
/gene="TNFRSF12A"
/gene_synonym="CD266; FN14; TWEAKR"
/replace="c"
/replace="g"
/db_xref="dbSNP:146183720"
ORIGIN
aaggcgggggcgggggcggggcggcggccgtgggtccctgccggccggcggcgggcgcagacagcggcgggcgcaggacgtgcactatggctcggggctcgctgcgccggttgctgcggctcctcgtgctggggctctggctggcgttgctgcgctccgtggccggggagcaagcgccaggcaccgccccctgctcccgcggcagctcctggagcgcggacctggacaagtgcatggactgcgcgtcttgcagggcgcgaccgcacagcgacttctgcctgggctgcgctgcagcacctcctgcccccttccggctgctttggcccatccttgggggcgctctgagcctgaccttcgtgctggggctgctttctggctttttggtctggagacgatgccgcaggagagagaagttcaccacccccatagaggagaccggcggagagggctgcccagctgtggcgctgatccagtgacaatgtgccccctgccagccggggctcgcccactcatcattcattcatccattctagagccagtctctgcctcccagacgcggcgggagccaagctcctccaaccacaaggggggtggggggcggtgaatcacctctgaggcctgggcccagggttcaggggaaccttccaaggtgtctggttgccctgcctctggctccagaacagaaagggagcctcacgctggctcacacaaaacagctgacactgactaaggaactgcagcatttgcacaggggaggggggtgccctccttcctagaggccctgggggccaggctgacttggggggcagacttgacactaggccccactcactcagatgtcctgaaattccaccacgggggtcaccctggggggttagggacctatttttaacactagggggctggcccactaggagggctggccctaagatacagacccccccaactccccaaagcggggaggagatatttattttggggagagtttggaggggagggagaatttattaataaaagaatctttaactttaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:51330 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:51330 -> Biological process: GO:0001525 [angiogenesis] evidence: IEA
GeneID:51330 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:51330 -> Biological process: GO:0006928 [cellular component movement] evidence: TAS
GeneID:51330 -> Biological process: GO:0006931 [substrate-dependent cell migration, cell attachment to substrate] evidence: IEA
GeneID:51330 -> Biological process: GO:0007275 [multicellular organismal development] evidence: TAS
GeneID:51330 -> Biological process: GO:0045773 [positive regulation of axon extension] evidence: IEA
GeneID:51330 -> Biological process: GO:2001238 [positive regulation of extrinsic apoptotic signaling pathway] evidence: IMP
GeneID:51330 -> Cellular component: GO:0001726 [ruffle] evidence: IEA
GeneID:51330 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
GeneID:51330 -> Cellular component: GO:0009986 [cell surface] evidence: IEA
GeneID:51330 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.