Home |
Help |
Advanced search
2024-04-19 13:50:07, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_016561 3060 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens bifunctional apoptosis regulator (BFAR), mRNA.
ACCESSION NM_016561
VERSION NM_016561.2 GI:228008338
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3060)
AUTHORS Li,H., Shi,H. and Huo,K.
TITLE p75NTR signal transduction suppressed by BFAR and p75NTR
interactions
JOURNAL Sci China Life Sci 55 (4), 367-374 (2012)
PUBMED 22566094
REMARK GeneRIF: Data show that p75NTR and BFAR co-localized within the
cytoplasm.
REFERENCE 2 (bases 1 to 3060)
AUTHORS Rong,J., Chen,L., Toth,J.I., Tcherpakov,M., Petroski,M.D. and
Reed,J.C.
TITLE Bifunctional apoptosis regulator (BAR), an endoplasmic reticulum
(ER)-associated E3 ubiquitin ligase, modulates BI-1 protein
stability and function in ER Stress
JOURNAL J. Biol. Chem. 286 (2), 1453-1463 (2011)
PUBMED 21068390
REMARK GeneRIF: post-translational regulation of the BI-1 protein by E3
ligase BAR contributes to the dynamic control of IRE1 signaling
during endoplasmic reticulum stress
REFERENCE 3 (bases 1 to 3060)
AUTHORS Liu,X., Zhao,P., Tang,S., Lu,F., Hu,J., Lei,C., Yang,X., Lin,Y.,
Ma,S., Yang,J., Zhang,D., Shi,Y., Li,T., Chen,Y., Fan,Y. and
Yang,Z.
TITLE Association study of complement factor H, C2, CFB, and C3 and
age-related macular degeneration in a Han Chinese population
JOURNAL Retina (Philadelphia, Pa.) 30 (8), 1177-1184 (2010)
PUBMED 20523265
REMARK GeneRIF: Observational study of gene-disease association. (HuGE
Navigator)
REFERENCE 4 (bases 1 to 3060)
AUTHORS Chua,C.C., Gao,J., Ho,Y.S., Xu,X., Kuo,I.C., Chua,K.Y., Wang,H.,
Hamdy,R.C., Reed,J.C. and Chua,B.H.
TITLE Over-expression of a modified bifunctional apoptosis regulator
protects against cardiac injury and doxorubicin-induced
cardiotoxicity in transgenic mice
JOURNAL Cardiovasc. Res. 81 (1), 20-27 (2009)
PUBMED 18805781
REMARK GeneRIF: Over-expression of BFAR Delta RING renders the heart more
resistant to I/R injury and DOX-induced cardiotoxicity, and this
protection correlates with reduced cardiomyocyte apoptosis.
REFERENCE 5 (bases 1 to 3060)
AUTHORS Roth,W., Kermer,P., Krajewska,M., Welsh,K., Davis,S., Krajewski,S.
and Reed,J.C.
TITLE Bifunctional apoptosis inhibitor (BAR) protects neurons from
diverse cell death pathways
JOURNAL Cell Death Differ. 10 (10), 1178-1187 (2003)
PUBMED 14502241
REFERENCE 6 (bases 1 to 3060)
AUTHORS Zhang,H., Xu,Q., Krajewski,S., Krajewska,M., Xie,Z., Fuess,S.,
Kitada,S., Pawlowski,K., Godzik,A. and Reed,J.C.
TITLE BAR: An apoptosis regulator at the intersection of caspases and
Bcl-2 family proteins
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 97 (6), 2597-2602 (2000)
PUBMED 10716992
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BI912683.1, BC003054.1, AF173003.1 and BU621058.1.
On Apr 29, 2009 this sequence version replaced gi:7706090.
##Evidence-Data-START##
Transcript exon combination :: AF173003.1, BC003054.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-169 BI912683.1 1-169
170-1943 BC003054.1 1-1774
1944-2658 AF173003.1 1816-2530
2659-3060 BU621058.1 1-402 c
FEATURES Location/Qualifiers
source 1..3060
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="16"
/map="16p13.12"
gene 1..3060
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/note="bifunctional apoptosis regulator"
/db_xref="GeneID:51283"
/db_xref="HGNC:17613"
/db_xref="HPRD:16548"
exon 1..208
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="alignment:Splign:1.39.8"
variation 134
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:181227319"
exon 209..544
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="alignment:Splign:1.39.8"
STS 227..383
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/standard_name="SHGC-61074"
/db_xref="UniSTS:27342"
variation 238
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:376278806"
variation 264
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:370320238"
variation 275
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:12917767"
misc_feature 276..278
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/note="upstream in-frame stop codon"
CDS 282..1634
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/note="RING finger protein 47; bifunctional apoptosis
inhibitor"
/codon_start=1
/product="bifunctional apoptosis regulator"
/protein_id="NP_057645.1"
/db_xref="GI:7706091"
/db_xref="CCDS:CCDS10554.1"
/db_xref="GeneID:51283"
/db_xref="HGNC:17613"
/db_xref="HPRD:16548"
/translation="
MEEPQKSYVNTMDLERDEPLKSTGPQISVSEFSCHCCYDILVNPTTLNCGHSFCRHCLALWWASSKKTECPECREKWEGFPKVSILLRDAIEKLFPDAIRLRFEDIQQNNDIVQSLAAFQKYGNDQIPLAPNTGRANQQMGGGFFSGVLTALTGVAVVLLVYHWSSRESEHDLLVHKAVAKWTAEEVVLWLEQLGPWASLYRERFLSERVNGRLLLTLTEEEFSKTPYTIENSSHRRAILMELERVKALGVKPPQNLWEYKAVNPGRSLFLLYALKSSPRLSLLYLYLFDYTDTFLPFIHTICPLQEDSSGEDIVTKLLDLKEPTWKQWREFLVKYSFLPYQLIAEFAWDWLEVHYWTSRFLIINAMLLSVLELFSFWRIWSRSELKTVPQRMWSHFWKVSTQGLFVAMFWPLIPQFVCNCLFYWALYFNPIINIDLVVKELRRLETQVL
"
misc_feature 369..506
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/note="Zinc finger, C3HC4 type (RING finger); Region:
zf-C3HC4_2; pfam13923"
/db_xref="CDD:206094"
misc_feature 378..512
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/note="RING-finger (Really Interesting New Gene) domain, a
specialized type of Zn-finger of 40 to 60 residues that
binds two atoms of zinc; defined by the 'cross-brace'
motif C-X2-C-X(9-39)-C-X(1-3)-
H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved
in...; Region: RING; cd00162"
/db_xref="CDD:29102"
misc_feature order(381..383,390..392,426..428,432..434,441..443,
450..452,489..491,498..500)
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/note="cross-brace motif; other site"
/db_xref="CDD:29102"
misc_feature 702..764
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NZS9.1);
transmembrane region"
misc_feature 816..1028
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/note="SAM domain of BAR subfamily; Region: SAM_BAR;
cd09513"
/db_xref="CDD:188912"
misc_feature 825..1022
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/note="SAM domain (Sterile alpha motif); Region: SAM_2;
pfam07647"
/db_xref="CDD:203706"
misc_feature 1275..1337
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NZS9.1);
transmembrane region"
misc_feature 1362..1424
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NZS9.1);
transmembrane region"
misc_feature 1494..1556
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9NZS9.1);
transmembrane region"
variation 283
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:142906937"
variation 291
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:147018669"
variation 305
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:370989353"
variation 310
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:201683680"
variation 314
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:376162124"
variation 335
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="t"
/db_xref="dbSNP:200654253"
variation 336
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:138184030"
variation 350
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:180778462"
variation 351
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:143466828"
variation 352
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:11546304"
variation 394
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:79546825"
variation 395
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:148640521"
variation 401
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:140014548"
variation 488
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:113811990"
variation 489
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="t"
/db_xref="dbSNP:368262540"
variation 534
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:372892824"
exon 545..749
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="alignment:Splign:1.39.8"
variation 550
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:181950167"
variation 576
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:138008477"
variation 597
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:150884036"
variation 615
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:367798533"
variation 650
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:375293504"
variation 684
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:139661061"
variation 689
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:375251653"
variation 700
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="g"
/replace="t"
/db_xref="dbSNP:11546303"
variation 723
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:146162152"
variation 725
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:140181133"
variation 726
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:149783391"
variation 728
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:200143894"
variation 734
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="g"
/replace="t"
/db_xref="dbSNP:145688957"
exon 750..919
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="alignment:Splign:1.39.8"
variation 755
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:148268157"
variation 761
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:186678539"
variation 766
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:374646053"
variation 781
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:368712217"
variation 789
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:200969701"
variation 829
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:201159611"
variation 833
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:142851831"
variation 848
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:200444771"
variation 857
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:371409176"
variation 865
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:375968701"
variation 907
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:151058471"
exon 920..1064
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="alignment:Splign:1.39.8"
variation 933
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:369591527"
variation 959
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:372322096"
variation 964
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:370231919"
variation 969
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:373405835"
variation 1015
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:35377618"
variation 1017
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:146982533"
variation 1032
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:140846801"
variation 1039
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:142229539"
exon 1065..1238
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="alignment:Splign:1.39.8"
variation 1097
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:146402847"
variation 1100
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:138366498"
variation 1132
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:371002666"
variation 1151
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:375012268"
variation 1187
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:149275652"
variation 1208
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:138464819"
variation 1221
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="c"
/db_xref="dbSNP:181013614"
variation 1223
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:376735482"
variation 1224
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:141864123"
exon 1239..1441
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="alignment:Splign:1.39.8"
variation 1256
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:145790811"
variation 1291
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:137925406"
variation 1404
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:184305004"
variation 1430
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="c"
/db_xref="dbSNP:200622080"
exon 1442..3043
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/inference="alignment:Splign:1.39.8"
variation 1448
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:377198999"
variation 1452
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:368858069"
variation 1478
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:184545551"
variation 1481
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:146121141"
variation 1487
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:369606672"
variation 1535
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:372838552"
variation 1582
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="t"
/db_xref="dbSNP:199732417"
variation 1640
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:370732014"
variation 1669
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:117674105"
variation 1808
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:72789518"
variation 1826
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:147190781"
variation 1827
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:369386389"
variation 1906
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:11546305"
variation 1919
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:79345307"
variation 2004
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:187424216"
variation 2154
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:117485751"
STS 2201..2329
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/standard_name="RH48705"
/db_xref="UniSTS:32312"
variation 2328
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:191958308"
variation 2426
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="g"
/db_xref="dbSNP:184996762"
variation 2471
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:189505934"
variation 2517
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:181051876"
variation 2530
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:373102913"
variation 2536
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="c"
/db_xref="dbSNP:112202809"
variation 2620
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="g"
/replace="t"
/db_xref="dbSNP:369553081"
variation 2783
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="a"
/replace="g"
/db_xref="dbSNP:184333609"
STS 2841..2936
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/standard_name="D16S2565E"
/db_xref="UniSTS:42708"
variation 2954
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="g"
/replace="t"
/db_xref="dbSNP:188107496"
variation 3004
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:1057966"
variation 3026
/gene="BFAR"
/gene_synonym="BAR; RNF47"
/replace="c"
/replace="t"
/db_xref="dbSNP:114300158"
ORIGIN
gggagtggccgctctaggcagcggggaggtcgcggggttgaggggggttgtgaaaggagagcggcctctcctctatggtcacggggccggggcacgcttcccccactctgtcttgttacttccggtagcgaagcctctccctcttcctctgctcccgcggggtctgtgctgagaataatggcccggttggcccgggacgagtggaatgattaatgatgttttgcagcagttttctacgtctgaaattttttatgtctctggaacccagaatttgctaagagatggaggaacctcagaaaagctatgtgaacacaatggaccttgagagagatgaacctctcaaaagcaccggccctcagatttctgttagtgaattttcttgccactgctgctacgacatcctggttaaccccaccaccttgaactgtgggcacagcttctgccgtcactgccttgctttatggtgggcatcttcaaagaaaacagaatgtccagaatgcagagaaaaatgggaaggtttccccaaagtcagtattctcctcagggatgccattgaaaagttatttcctgatgccattagactgagatttgaagacattcagcagaataatgacatagtccaaagtcttgcagcctttcagaaatatgggaatgatcagattcctttagctcctaacacaggccgagcgaatcagcagatgggagggggattcttttccggtgtgctcacagctttaactggagtggcagtggtcctgctcgtctatcactggagcagcagggaatctgaacacgacctcctggtccacaaggctgtggccaaatggacggcggaagaagttgtcctctggctggagcagctgggcccttgggcatctctttacagggaaaggtttttatctgaacgagtaaatggaaggttgcttttaactttgacagaggaagaattttccaagacgccctataccatagaaaacagcagccacaggagagccatcctcatggagctagaacgtgtcaaagcattaggcgtgaagcccccccagaatctctgggaatataaggctgtgaacccaggcaggtccctgttcctgctatacgccctcaagagctcccccaggctgagtctgctctacctgtacctgtttgactacaccgacaccttcctacctttcatccacaccatctgccctctgcaagaagacagctctggggaggacatcgtcaccaagcttctggatcttaaggagcctacgtggaagcagtggagagagttcctggtcaaatactccttccttccataccagctgattgctgagtttgcttgggactggttggaggtccattactggacatcacggtttctcatcatcaatgctatgttactctcagttctggaattattctccttttggagaatctggtcgagaagtgaactgaagaccgtgcctcagaggatgtggagccatttctggaaagtatcaacgcaggggctttttgtggccatgttctggcccctcatccctcagtttgtttgcaactgtttgttttactgggccctgtactttaacccaattattaacattgatcttgtggtcaaggaactccggcggctggaaacccaggtgttgtgactggcactgcccaggctgagactcttcaagtcccgctgacgtctgagctttgatgcttaagaggggtgaggcagggagcggacttcctattttctaccctcagtaaaacaaggtgctgctttgtatatcaaaagctccaaccatgtcctctccccctcagcctgtgggtggcacgagcaaggactgacatccgcacagggaggattgtctgtttggctgacacagcagcagcccttcccacccagccaccttcctcacagggactaggaggctcagtccccaacggctggcaagactcagggtcctcagtggacatggtgtgggtgacatcagaagggtgccacatcagtcccctccccaacctcagtgactgacagaggatccggatctcagagcctgagaccaggtttattggggcctggcctgtcctctaagtcaagtttaggaaaacaaggataagattctgtcataggcatagagagttgcacataaaaaataccgaagaaaacccaaaattcaatcaacaattctgtcttattgaagagttgctaggattcagagtaaaactcaaaggattcagtttgagcctagaatgatggttagacttgtagtcactgggcttttgttttgctttatggaaatcattgaaggtctggatccctttctctgaatggagagattgagagggatgtcgggcagttcccattagatttagtggccttcatgttattcagaattgttttggtgatacctcacccctgtaatcccagcactttgggtgggtgaggcaggcggatcacttgaagccaggacttcaagaccagcttggccaacatggtgaaacctcatctctactaaaaatacaaaaattagccaagtgtgatggcacatacctgtaatcccagctacttggaattggaaatcgcctgaacccaggaggcggaggttgcagggagggagactgcaccactgcacttcagcctgggtgacagagggagactctgtcttaaaaaaaaaaaaaaaatcatctgtaaaataaattccgggatagtcgttttgttcaaggaaatgttttgtaaattgagctcacactatataatctttattgtcctatcctgatgtataatacagcaggtataattacaccaagcgctatagttataaatatggcatgaagtgaactatggccttttatttccttccagtgtgaacacagcaggtgtgagatgtcatcttggaagacaggccttgcagaaataggcctacatccaaaatattatcttgtgactccatgaaccattcattaaccctttgtatctttgagtgaaaattttactcaaaagttgcatctggaagttcgaagaaattacttgaaataaaaataaagatttctatatagataaaacctaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:51283 -> Molecular function: GO:0005198 [structural molecule activity] evidence: TAS
GeneID:51283 -> Molecular function: GO:0008270 [zinc ion binding] evidence: IEA
GeneID:51283 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:51283 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IDA
GeneID:51283 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: IEA
GeneID:51283 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
GeneID:51283 -> Cellular component: GO:0016020 [membrane] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.