Home |
Help |
Advanced search
2024-04-25 11:33:14, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_016542 3352 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens serine/threonine protein kinase MST4 (MST4),
transcript variant 1, mRNA.
ACCESSION NM_016542
VERSION NM_016542.3 GI:109633024
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3352)
AUTHORS Xu,X., Wang,X., Ding,J. and Wang,D.C.
TITLE Crystallization and preliminary crystallographic studies of CCM3 in
complex with the C-terminal domain of MST4
JOURNAL Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 68 (PT 7),
760-763 (2012)
PUBMED 22750858
REMARK GeneRIF: crystal of the CCM3-MST4 C-terminal domain complex
belonged to space group P4(1)2(1)2 or P4(3)2(1)2, with unit-cell
parameters a = 69.10, b = 69.10, c = 117.57 A
REFERENCE 2 (bases 1 to 3352)
AUTHORS ten Klooster,J.P., Jansen,M., Yuan,J., Oorschot,V., Begthel,H., Di
Giacomo,V., Colland,F., de Koning,J., Maurice,M.M., Hornbeck,P. and
Clevers,H.
TITLE Mst4 and Ezrin induce brush borders downstream of the
Lkb1/Strad/Mo25 polarization complex
JOURNAL Dev. Cell 16 (4), 551-562 (2009)
PUBMED 19386264
REMARK GeneRIF: These data define a brush border induction pathway
downstream of the Lkb1/Strad/Mo25 polarization complex, yet
separate from other polarity events.
REFERENCE 3 (bases 1 to 3352)
AUTHORS Goudreault,M., D'Ambrosio,L.M., Kean,M.J., Mullin,M.J.,
Larsen,B.G., Sanchez,A., Chaudhry,S., Chen,G.I., Sicheri,F.,
Nesvizhskii,A.I., Aebersold,R., Raught,B. and Gingras,A.C.
TITLE A PP2A phosphatase high density interaction network identifies a
novel striatin-interacting phosphatase and kinase complex linked to
the cerebral cavernous malformation 3 (CCM3) protein
JOURNAL Mol. Cell Proteomics 8 (1), 157-171 (2009)
PUBMED 18782753
REFERENCE 4 (bases 1 to 3352)
AUTHORS Ma,X., Zhao,H., Shan,J., Long,F., Chen,Y., Chen,Y., Zhang,Y.,
Han,X. and Ma,D.
TITLE PDCD10 interacts with Ste20-related kinase MST4 to promote cell
growth and transformation via modulation of the ERK pathway
JOURNAL Mol. Biol. Cell 18 (6), 1965-1978 (2007)
PUBMED 17360971
REMARK GeneRIF: Results show that PDCD10 modulation of ERK signaling is
mediated by MST4, and that PDCD10 may be a regulatory adaptor
necessary for MST4 function, suggesting a link between cerebral
cavernous malformation and the ERK-MAPK cascade via PDCD10/MST4.
REFERENCE 5 (bases 1 to 3352)
AUTHORS Ross,M.T., Grafham,D.V., Coffey,A.J., Scherer,S., McLay,K.,
Muzny,D., Platzer,M., Howell,G.R., Burrows,C., Bird,C.P.,
Frankish,A., Lovell,F.L., Howe,K.L., Ashurst,J.L., Fulton,R.S.,
Sudbrak,R., Wen,G., Jones,M.C., Hurles,M.E., Andrews,T.D.,
Scott,C.E., Searle,S., Ramser,J., Whittaker,A., Deadman,R.,
Carter,N.P., Hunt,S.E., Chen,R., Cree,A., Gunaratne,P., Havlak,P.,
Hodgson,A., Metzker,M.L., Richards,S., Scott,G., Steffen,D.,
Sodergren,E., Wheeler,D.A., Worley,K.C., Ainscough,R.,
Ambrose,K.D., Ansari-Lari,M.A., Aradhya,S., Ashwell,R.I.,
Babbage,A.K., Bagguley,C.L., Ballabio,A., Banerjee,R., Barker,G.E.,
Barlow,K.F., Barrett,I.P., Bates,K.N., Beare,D.M., Beasley,H.,
Beasley,O., Beck,A., Bethel,G., Blechschmidt,K., Brady,N.,
Bray-Allen,S., Bridgeman,A.M., Brown,A.J., Brown,M.J., Bonnin,D.,
Bruford,E.A., Buhay,C., Burch,P., Burford,D., Burgess,J.,
Burrill,W., Burton,J., Bye,J.M., Carder,C., Carrel,L., Chako,J.,
Chapman,J.C., Chavez,D., Chen,E., Chen,G., Chen,Y., Chen,Z.,
Chinault,C., Ciccodicola,A., Clark,S.Y., Clarke,G., Clee,C.M.,
Clegg,S., Clerc-Blankenburg,K., Clifford,K., Cobley,V., Cole,C.G.,
Conquer,J.S., Corby,N., Connor,R.E., David,R., Davies,J., Davis,C.,
Davis,J., Delgado,O., Deshazo,D., Dhami,P., Ding,Y., Dinh,H.,
Dodsworth,S., Draper,H., Dugan-Rocha,S., Dunham,A., Dunn,M.,
Durbin,K.J., Dutta,I., Eades,T., Ellwood,M., Emery-Cohen,A.,
Errington,H., Evans,K.L., Faulkner,L., Francis,F., Frankland,J.,
Fraser,A.E., Galgoczy,P., Gilbert,J., Gill,R., Glockner,G.,
Gregory,S.G., Gribble,S., Griffiths,C., Grocock,R., Gu,Y.,
Gwilliam,R., Hamilton,C., Hart,E.A., Hawes,A., Heath,P.D.,
Heitmann,K., Hennig,S., Hernandez,J., Hinzmann,B., Ho,S., Hoffs,M.,
Howden,P.J., Huckle,E.J., Hume,J., Hunt,P.J., Hunt,A.R.,
Isherwood,J., Jacob,L., Johnson,D., Jones,S., de Jong,P.J.,
Joseph,S.S., Keenan,S., Kelly,S., Kershaw,J.K., Khan,Z.,
Kioschis,P., Klages,S., Knights,A.J., Kosiura,A., Kovar-Smith,C.,
Laird,G.K., Langford,C., Lawlor,S., Leversha,M., Lewis,L., Liu,W.,
Lloyd,C., Lloyd,D.M., Loulseged,H., Loveland,J.E., Lovell,J.D.,
Lozado,R., Lu,J., Lyne,R., Ma,J., Maheshwari,M., Matthews,L.H.,
McDowall,J., McLaren,S., McMurray,A., Meidl,P., Meitinger,T.,
Milne,S., Miner,G., Mistry,S.L., Morgan,M., Morris,S., Muller,I.,
Mullikin,J.C., Nguyen,N., Nordsiek,G., Nyakatura,G., O'Dell,C.N.,
Okwuonu,G., Palmer,S., Pandian,R., Parker,D., Parrish,J.,
Pasternak,S., Patel,D., Pearce,A.V., Pearson,D.M., Pelan,S.E.,
Perez,L., Porter,K.M., Ramsey,Y., Reichwald,K., Rhodes,S.,
Ridler,K.A., Schlessinger,D., Schueler,M.G., Sehra,H.K.,
Shaw-Smith,C., Shen,H., Sheridan,E.M., Shownkeen,R., Skuce,C.D.,
Smith,M.L., Sotheran,E.C., Steingruber,H.E., Steward,C.A.,
Storey,R., Swann,R.M., Swarbreck,D., Tabor,P.E., Taudien,S.,
Taylor,T., Teague,B., Thomas,K., Thorpe,A., Timms,K., Tracey,A.,
Trevanion,S., Tromans,A.C., d'Urso,M., Verduzco,D., Villasana,D.,
Waldron,L., Wall,M., Wang,Q., Warren,J., Warry,G.L., Wei,X.,
West,A., Whitehead,S.L., Whiteley,M.N., Wilkinson,J.E.,
Willey,D.L., Williams,G., Williams,L., Williamson,A.,
Williamson,H., Wilming,L., Woodmansey,R.L., Wray,P.W., Yen,J.,
Zhang,J., Zhou,J., Zoghbi,H., Zorilla,S., Buck,D., Reinhardt,R.,
Poustka,A., Rosenthal,A., Lehrach,H., Meindl,A., Minx,P.J.,
Hillier,L.W., Willard,H.F., Wilson,R.K., Waterston,R.H., Rice,C.M.,
Vaudin,M., Coulson,A., Nelson,D.L., Weinstock,G., Sulston,J.E.,
Durbin,R., Hubbard,T., Gibbs,R.A., Beck,S., Rogers,J. and
Bentley,D.R.
TITLE The DNA sequence of the human X chromosome
JOURNAL Nature 434 (7031), 325-337 (2005)
PUBMED 15772651
REFERENCE 6 (bases 1 to 3352)
AUTHORS Dan,I., Ong,S.E., Watanabe,N.M., Blagoev,B., Nielsen,M.M.,
Kajikawa,E., Kristiansen,T.Z., Mann,M. and Pandey,A.
TITLE Cloning of MASK, a novel member of the mammalian germinal center
kinase III subfamily, with apoptosis-inducing properties
JOURNAL J. Biol. Chem. 277 (8), 5929-5939 (2002)
PUBMED 11741893
REMARK GeneRIF: cloning of a germinal center iii kinase that induces
apoptosis
REFERENCE 7 (bases 1 to 3352)
AUTHORS Lin,J.L., Chen,H.C., Fang,H.I., Robinson,D., Kung,H.J. and
Shih,H.M.
TITLE MST4, a new Ste20-related kinase that mediates cell growth and
transformation via modulating ERK pathway
JOURNAL Oncogene 20 (45), 6559-6569 (2001)
PUBMED 11641781
REFERENCE 8 (bases 1 to 3352)
AUTHORS Qian,Z., Lin,C., Espinosa,R., LeBeau,M. and Rosner,M.R.
TITLE Cloning and characterization of MST4, a novel Ste20-like kinase
JOURNAL J. Biol. Chem. 276 (25), 22439-22445 (2001)
PUBMED 11306563
REFERENCE 9 (bases 1 to 3352)
AUTHORS Dan,I., Watanabe,N.M. and Kusumi,A.
TITLE The Ste20 group kinases as regulators of MAP kinase cascades
JOURNAL Trends Cell Biol. 11 (5), 220-230 (2001)
PUBMED 11316611
REFERENCE 10 (bases 1 to 3352)
AUTHORS Liu,K.C. and Wang,D.
TITLE [Synthesis of n-substituted beta-methyl DL-aspartates as potential
hypocholesteremics (author's transl)]
JOURNAL Arch. Pharm. (Weinheim) 308 (7), 564-570 (1975)
PUBMED 1164178
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA760264.1, AF231012.1 and
BC070056.1.
This sequence is a reference standard in the RefSeqGene project.
On Jun 23, 2006 this sequence version replaced gi:15011879.
Summary: The product of this gene is a member of the GCK group III
family of kinases, which are a subset of the Ste20-like kinases.
The encoded protein contains an amino-terminal kinase domain, and a
carboxy-terminal regulatory domain that mediates homodimerization.
The protein kinase localizes to the Golgi apparatus and is
specifically activated by binding to the Golgi matrix protein
GM130. It is also cleaved by caspase-3 in vitro, and may function
in the apoptotic pathway. Several alternatively spliced transcript
variants of this gene have been described, but the full-length
nature of some of these variants has not been determined. [provided
by RefSeq, Jul 2008].
Transcript Variant: This variant (1) represents the predominant
transcript and encodes the longest isoform (1).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC070056.1, BC099843.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025088, ERS025089 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-112 DA760264.1 4-115
113-1959 AF231012.1 1-1847
1960-2836 BC070056.1 1875-2751
2837-3352 BC070056.1 2753-3268
FEATURES Location/Qualifiers
source 1..3352
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="X"
/map="Xq26.2"
gene 1..3352
/gene="MST4"
/gene_synonym="MASK"
/note="serine/threonine protein kinase MST4"
/db_xref="GeneID:51765"
/db_xref="HPRD:06663"
/db_xref="MIM:300547"
exon 1..191
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
misc_feature 59..61
/gene="MST4"
/gene_synonym="MASK"
/note="upstream in-frame stop codon"
variation 119
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:373943539"
exon 192..343
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 288
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="c"
/db_xref="dbSNP:112781699"
CDS 302..1552
/gene="MST4"
/gene_synonym="MASK"
/EC_number="2.7.11.1"
/note="isoform 1 is encoded by transcript variant 1;
STE20-like kinase MST4; Mst3 and SOK1-related kinase;
mammalian Ste20-like protein kinase 4; mammalian sterile
20-like 4; serine/threonine-protein kinase MASK"
/codon_start=1
/product="serine/threonine-protein kinase MST4 isoform 1"
/protein_id="NP_057626.2"
/db_xref="GI:15011880"
/db_xref="CCDS:CCDS14631.1"
/db_xref="GeneID:51765"
/db_xref="HPRD:06663"
/db_xref="MIM:300547"
/translation="
MAHSPVAVQVPGMQNNIADPEELFTKLERIGKGSFGEVFKGIDNRTQQVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSSYVTKYYGSYLKGSKLWIIMEYLGGGSALDLLRAGPFDEFQIATMLKEILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIQQSAYDSKADIWSLGITAIELAKGEPPNSDMHPMRVLFLIPKNNPPTLVGDFTKSFKEFIDACLNKDPSFRPTAKELLKHKFIVKNSKKTSYLTELIDRFKRWKAEGHSDDESDSEGSDSESTSRENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP
"
misc_feature 356..1186
/gene="MST4"
/gene_synonym="MASK"
/note="Catalytic domain of the Protein Serine/Threonine
Kinase, Mammalian Ste20-like protein kinase 4; Region:
STKc_MST4; cd06640"
/db_xref="CDD:132971"
misc_feature 371..1123
/gene="MST4"
/gene_synonym="MASK"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(389..403,413..415,452..454,458..460,509..511,
548..550,596..607,614..619,626..628,731..733,737..748,
752..754,785..787,794..796,836..847,851..853,932..934,
959..961)
/gene="MST4"
/gene_synonym="MASK"
/note="active site"
/db_xref="CDD:132971"
misc_feature order(389..403,413..415,452..454,458..460,509..511,
548..550,596..607,614..619,626..628,743..748,752..754,
785..787)
/gene="MST4"
/gene_synonym="MASK"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:132971"
misc_feature order(398..403,731..733,737..745,794..796,836..847,
851..853,932..934,959..961)
/gene="MST4"
/gene_synonym="MASK"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:132971"
misc_feature 782..853
/gene="MST4"
/gene_synonym="MASK"
/note="activation loop (A-loop); other site"
/db_xref="CDD:132971"
misc_feature 833..835
/gene="MST4"
/gene_synonym="MASK"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by autocatalysis; propagated from
UniProtKB/Swiss-Prot (Q9P289.2); phosphorylation site"
misc_feature 833..835
/gene="MST4"
/gene_synonym="MASK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:06663"
variation 327
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:56035648"
variation 328
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="t"
/db_xref="dbSNP:369364323"
exon 344..574
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 358
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:11555984"
variation 364
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:146889914"
variation 386
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:375587063"
variation 434
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:56044451"
variation 480
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:193206254"
variation 502
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:141788407"
variation 556
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:150155667"
variation 558
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="t"
/db_xref="dbSNP:138637956"
exon 575..631
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
exon 632..740
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 665
/gene="MST4"
/gene_synonym="MASK"
/replace="g"
/replace="t"
/db_xref="dbSNP:146294919"
variation 678
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:375206609"
variation 727
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:139634080"
variation 728
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:369853762"
exon 741..898
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 832
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="t"
/db_xref="dbSNP:142833022"
variation 894
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:201522308"
exon 899..1084
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 929
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:148760250"
variation 934
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:142399454"
variation 949
/gene="MST4"
/gene_synonym="MASK"
/replace="g"
/replace="t"
/db_xref="dbSNP:201758864"
variation 1014
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:201682759"
variation 1068
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:376757777"
exon 1085..1233
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 1087
/gene="MST4"
/gene_synonym="MASK"
/replace="g"
/replace="t"
/db_xref="dbSNP:150917439"
variation 1135
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:139399862"
variation 1170
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:144238597"
STS 1173..1302
/gene="MST4"
/gene_synonym="MASK"
/standard_name="RH65695"
/db_xref="UniSTS:65096"
variation 1216
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:3210621"
variation 1219
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:56021439"
variation 1223
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="g"
/db_xref="dbSNP:141248916"
exon 1234..1327
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 1268
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:3210622"
variation 1309
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="g"
/db_xref="dbSNP:370089311"
variation 1323
/gene="MST4"
/gene_synonym="MASK"
/replace="g"
/replace="t"
/db_xref="dbSNP:145082590"
exon 1328..1390
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 1363
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:145005460"
exon 1391..1527
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 1414
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:371247497"
variation 1444
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:34419165"
variation 1458
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:201251228"
variation 1471
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:374158091"
variation 1476
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:141969228"
exon 1528..3336
/gene="MST4"
/gene_synonym="MASK"
/inference="alignment:Splign:1.39.8"
variation 1543
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:367783889"
variation 1547
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:149095600"
variation 1565
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:368300222"
STS 1694..1819
/gene="MST4"
/gene_synonym="MASK"
/standard_name="RH16585"
/db_xref="UniSTS:53890"
variation 1952
/gene="MST4"
/gene_synonym="MASK"
/replace=""
/replace="t"
/db_xref="dbSNP:373523628"
variation 1960..1961
/gene="MST4"
/gene_synonym="MASK"
/replace=""
/replace="a"
/db_xref="dbSNP:200019710"
variation 1960
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="t"
/db_xref="dbSNP:5933061"
variation 1961..1962
/gene="MST4"
/gene_synonym="MASK"
/replace=""
/replace="a"
/db_xref="dbSNP:201033420"
variation 1961
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="t"
/db_xref="dbSNP:995246"
variation 1962
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="t"
/db_xref="dbSNP:190158958"
variation 2029
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="c"
/db_xref="dbSNP:370760997"
variation 2036
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="t"
/db_xref="dbSNP:182430156"
variation 2040
/gene="MST4"
/gene_synonym="MASK"
/replace="g"
/replace="t"
/db_xref="dbSNP:186750291"
variation 2105
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="t"
/db_xref="dbSNP:191219104"
variation 2249
/gene="MST4"
/gene_synonym="MASK"
/replace="g"
/replace="t"
/db_xref="dbSNP:185717782"
variation 2515
/gene="MST4"
/gene_synonym="MASK"
/replace="g"
/replace="t"
/db_xref="dbSNP:111875905"
variation 2592..2594
/gene="MST4"
/gene_synonym="MASK"
/replace=""
/replace="gat"
/db_xref="dbSNP:376484357"
STS 2794..2917
/gene="MST4"
/gene_synonym="MASK"
/standard_name="WI-16556"
/db_xref="UniSTS:45781"
variation 2939
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="g"
/db_xref="dbSNP:373630576"
variation 3084
/gene="MST4"
/gene_synonym="MASK"
/replace="a"
/replace="t"
/db_xref="dbSNP:189045844"
STS 3192..3319
/gene="MST4"
/gene_synonym="MASK"
/standard_name="WI-11835"
/db_xref="UniSTS:21460"
variation 3205
/gene="MST4"
/gene_synonym="MASK"
/replace="c"
/replace="g"
/db_xref="dbSNP:193010445"
polyA_signal 3313..3318
/gene="MST4"
/gene_synonym="MASK"
polyA_site 3336
/gene="MST4"
/gene_synonym="MASK"
ORIGIN
accgcctcccaggccaggcgagcaggcgggtggctggggcgcctccacctcctcttcctaaagcggcgaggcgcagaggagcggcatcactcgagcccaggtcccagccaccaccactcacagcgctcggcgttcaggaagaggagcagcagcggaggcggctgcttcagcggcgggcgggcgccagaaaggccccgatcgaaaagcctgggagggccgccgaactacccccggagggaggagccagtccgaacccaaggcgccaccgccgcagaagcggagcgaggcagcattcgcctccatggcccactcgccggtggctgtccaagtgcctgggatgcagaataacatagctgatccagaagaactgttcacaaaattagagcgcattgggaaaggctcatttggggaagttttcaaaggaattgataaccgtacccagcaagtcgttgctattaaaatcatagaccttgaggaagccgaagatgaaatagaagacattcagcaagaaataactgtcttgagtcaatgtgacagctcatatgtaacaaaatactatgggtcatatttaaaggggtctaaattatggataataatggaatacctgggcggtggttcagcactggatcttcttcgagctggtccatttgatgagttccagattgctaccatgctaaaggaaattttaaaaggtctggactatctgcattcagaaaagaaaattcaccgagacataaaagctgccaatgtcttgctctcagaacaaggagatgttaaacttgctgattttggagttgctggtcagctgacagatacacagattaaaagaaatacctttgtgggaactccattttggatggctcctgaagttattcaacagtcagcttatgactcaaaagctgacatttggtcattgggaattactgctattgaactagccaagggagagccacctaactccgatatgcatccaatgagagttctgtttcttattcccaaaaacaatcctccaactcttgttggagactttactaagtcttttaaggagtttattgatgcttgcctgaacaaagatccatcatttcgtcctacagcaaaagaacttctgaaacacaaattcattgtaaaaaattcaaagaagacttcttatctgactgaactgatagatcgttttaagagatggaaggcagaaggacacagtgatgatgaatctgattccgagggctctgattcggaatctaccagcagggaaaacaatactcatcctgaatggagctttaccaccgtacgaaagaagcctgatccaaagaaagtacagaatggggcagagcaagatcttgtgcaaaccctgagttgtttgtctatgataatcacacctgcatttgctgaacttaaacagcaggacgagaataacgctagcaggaatcaggcgattgaagaactcgagaaaagtattgctgtggctgaagccgcctgtcccggcatcacagataaaatggtgaagaaactaattgaaaaatttcaaaagtgttcagcagacgaatccccctaagaaacttattattggcttctgtttcatatggacccagagagccccaccaaacctacgtcaagattaacaatgcttaacccatgagctccatgtgccttttggatctttgcaacactgaagatttggaagaagctattaaactattttgtgatggcgtttatcattttatattttgaaaggattattttgtaaggaataacttttaatactatagtttcacctgtattctagtaaatgttgagacaccgttttgcttttaagtatccctatttcttaagttacgaggatgaatacctttcacattttgatctttagttgactctacagtcatgaaacatacaggtctttcaaagtcattctcaatattcagcttttgtaaattatcaagcttcaaaaagcttttttttttaaaaaaaaacatgcatattctaaaaatgactattggtggggaggtgtaaataagtcataccttcttaaaacagaaaatttaagtaaagtcttttaaatgaaacctgtaaaagtattgactcttctaccaagttggtatgatattccaggcagctcaatgattatcacatttgagaccctgtgtttgaagcatttacaggcaatgtacagcaacagaggtacctcttggtgtatagtatttacattctcttttaggtagaagaggcaattttacccttatttcacatggttagaaatttaaagcaagatcatttacccaaggataggtgtttggtaatgttgaaggagttagtctggcttcatgttttacatcttcaactaaaatcccatactatctgcttggatttggagagccaaaaaataaagctgattgtcatgtgattaaatatctgatcaacaggtatgaatataacttaaatcagcatatttttgccatggtaataaattgtcctataaactatttatatatttttgttcttcataattatcactaataagcatcagtttgttgtttttaaaaggatatttaagtgagcattttctagttcatatgaaaataaccatagtacaggatgatttctgtccacacaaaggttaaattagattgcacagttaattttcacttatatttatggtactattatgtgggtgatgcctttttcttttaagcccagtacatatattatgcctgcctaagttctgaactggggctgtatttcagtagttgtagaattattgatatttagttttgatagctaatgtttaattgtttggatctgcacagtttggtttttgcacaaaagtcatttaaaaaaatctgagtaattgtcaaatattaaaagaaagatattcttcctgtaaggaatacagtttttagtcaaagtggccattacatcctctttttaatttacataatacagatacttgagaaagttgttgtggtgttgtatgccaagaaaattctttttattggtgcctatattgtaacaattatttttaatgcattgtattttgaagtaacggttcagttaaatttttcacctgctgtgtaactgaaacacaattacagtttataatcatctgtagaagtctggagataattttgcaactcatgttatgggttaaatgaatatttttgtaaaagtaaaagcaacaaatttataaattgattatttgaaactttacaacacaattgcatcccaaatacaaattgtattgcttattcattatagctattcgtcctgtaatctgtttctaggtgaagcatactccagtgttttaggggttttgaaaataaatatttaaatttcacagtcaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:51765 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: IDA
GeneID:51765 -> Molecular function: GO:0004672 [protein kinase activity] evidence: IDA
GeneID:51765 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IEA
GeneID:51765 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:51765 -> Molecular function: GO:0005524 [ATP binding] evidence: IDA
GeneID:51765 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI
GeneID:51765 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:51765 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:51765 -> Biological process: GO:0006921 [cellular component disassembly involved in execution phase of apoptosis] evidence: TAS
GeneID:51765 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: IDA
GeneID:51765 -> Cellular component: GO:0000139 [Golgi membrane] evidence: IEA
GeneID:51765 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_057626 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.