Home |
Help |
Advanced search
2024-04-24 10:11:39, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_016459 845 bp mRNA linear PRI 24-JUN-2013
DEFINITION Homo sapiens marginal zone B and B1 cell-specific protein (MZB1),
mRNA.
ACCESSION NM_016459
VERSION NM_016459.3 GI:117938313
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 845)
AUTHORS Xia,L., Shen,C., Fu,Y., Tian,L. and Chen,M.
TITLE MGC29506 induces cell cycle arrest and is downregulated in gastric
cancer
JOURNAL Cell. Immunol. 281 (1), 31-36 (2013)
PUBMED 23434460
REMARK GeneRIF: results suggested that MGC29506 has the potential of
functioning as a novel suppressor gene in gastric cancer
REFERENCE 2 (bases 1 to 845)
AUTHORS Matsumura,S., Imoto,I., Kozaki,K., Matsui,T., Muramatsu,T.,
Furuta,M., Tanaka,S., Sakamoto,M., Arii,S. and Inazawa,J.
TITLE Integrative array-based approach identifies MZB1 as a frequently
methylated putative tumor suppressor in hepatocellular carcinoma
JOURNAL Clin. Cancer Res. 18 (13), 3541-3551 (2012)
PUBMED 22573353
REMARK GeneRIF: methylation-mediated silencing of MZB1 expression leads to
loss of its tumor-suppressive activity, which may be a factor in
hepatocarcinogenesis
REFERENCE 3 (bases 1 to 845)
AUTHORS Zhang,H., Chen,S. and Huang,L.
TITLE [Proteomics-based identification of proapoptotic caspase adapter
protein as a novel serum marker of non-small cell lung cancer]
JOURNAL Zhongguo Fei Ai Za Zhi 15 (5), 287-293 (2012)
PUBMED 22613335
REMARK GeneRIF: Data show that proapoptotic caspase adapter protein PACAP
is a potential serum marker of non-small cell lung cancer.
REFERENCE 4 (bases 1 to 845)
AUTHORS Zhang,H., Chen,X. and Sairam,M.R.
TITLE Novel hormone-regulated genes in visceral adipose tissue: cloning
and identification of proinflammatory cytokine-like mouse and human
MEDA-7: implications for obesity, insulin resistance and the
metabolic syndrome
JOURNAL Diabetologia 54 (9), 2368-2380 (2011)
PUBMED 21688198
REFERENCE 5 (bases 1 to 845)
AUTHORS Flach,H., Rosenbaum,M., Duchniewicz,M., Kim,S., Zhang,S.L.,
Cahalan,M.D., Mittler,G. and Grosschedl,R.
TITLE Mzb1 protein regulates calcium homeostasis, antibody secretion, and
integrin activation in innate-like B cells
JOURNAL Immunity 33 (5), 723-735 (2010)
PUBMED 21093319
REFERENCE 6 (bases 1 to 845)
AUTHORS Shimizu,Y., Meunier,L. and Hendershot,L.M.
TITLE pERp1 is significantly up-regulated during plasma cell
differentiation and contributes to the oxidative folding of
immunoglobulin
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 106 (40), 17013-17018 (2009)
PUBMED 19805157
REFERENCE 7 (bases 1 to 845)
AUTHORS van Anken,E., Pena,F., Hafkemeijer,N., Christis,C., Romijn,E.P.,
Grauschopf,U., Oorschot,V.M., Pertel,T., Engels,S., Ora,A.,
Lastun,V., Glockshuber,R., Klumperman,J., Heck,A.J., Luban,J. and
Braakman,I.
TITLE Efficient IgM assembly and secretion require the plasma cell
induced endoplasmic reticulum protein pERp1
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 106 (40), 17019-17024 (2009)
PUBMED 19805154
REFERENCE 8 (bases 1 to 845)
AUTHORS Katoh,M. and Katoh,M.
TITLE MGC29506 gene, frequently down-regulated in intestinal-type gastric
cancer, encodes secreted-type protein with conserved cysteine
residues
JOURNAL Int. J. Oncol. 23 (1), 235-241 (2003)
PUBMED 12792799
REMARK GeneRIF: MGC29506 gene, frequently down-regulated in
intestinal-type gastric cancer, was found to encode secreted-type
protein with six conserved cysteine residues [MGC29506]
REFERENCE 9 (bases 1 to 845)
AUTHORS Bonfoco,E., Li,E., Kolbinger,F. and Cooper,N.R.
TITLE Characterization of a novel proapoptotic caspase-2- and
caspase-9-binding protein
JOURNAL J. Biol. Chem. 276 (31), 29242-29250 (2001)
PUBMED 11350957
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BU601458.1 and BC021275.2.
On Nov 13, 2006 this sequence version replaced gi:24475968.
##Evidence-Data-START##
Transcript exon combination :: BC021275.2, AK292706.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025086 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-19 BU601458.1 3-21
20-845 BC021275.2 1-826
FEATURES Location/Qualifiers
source 1..845
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="5"
/map="5q31.2"
gene 1..845
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/note="marginal zone B and B1 cell-specific protein"
/db_xref="GeneID:51237"
/db_xref="HGNC:30125"
/db_xref="MIM:609447"
exon 1..237
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/inference="alignment:Splign:1.39.8"
CDS 61..630
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/note="plasma cell-induced ER protein 1; proapoptotic
caspase adaptor protein; caspase-2 binding protein;
HSPC190; proapoptotic caspase adapter protein; plasma
cell-induced resident endoplasmic reticulum protein;
plasma cell-induced resident ER protein; mesenteric
oestrogen-dependent adipose gene- 7; mesenteric
estrogen-dependent adipose 7; marginal zone B- and
B1-cell-specific protein"
/codon_start=1
/product="marginal zone B- and B1-cell-specific protein
precursor"
/protein_id="NP_057543.2"
/db_xref="GI:117938314"
/db_xref="CCDS:CCDS47273.1"
/db_xref="GeneID:51237"
/db_xref="HGNC:30125"
/db_xref="MIM:609447"
/translation="
MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
"
sig_peptide 61..126
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 127..627
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/product="Marginal zone B-and B1-cell-specific protein"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q8WU39.1)"
misc_feature 616..627
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q8WU39.1);
Region: Prevents secretion from ER (Potential)"
variation complement(85)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:138971367"
variation complement(110)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:114473756"
variation complement(140)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:202005958"
variation complement(158)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="c"
/db_xref="dbSNP:371520396"
variation complement(171)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="g"
/replace="t"
/db_xref="dbSNP:369432811"
variation complement(205)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:375343363"
exon 238..362
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/inference="alignment:Splign:1.39.8"
variation complement(264)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="g"
/db_xref="dbSNP:200921802"
variation complement(290)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:201837944"
variation complement(292)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:377114469"
variation complement(296)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:372600871"
variation complement(298)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:368642975"
variation complement(299)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:374843946"
variation complement(310)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:370291305"
variation complement(323)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:189193994"
variation complement(324)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="g"
/replace="t"
/db_xref="dbSNP:199549807"
variation complement(338)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:200793536"
variation complement(350)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:374721625"
exon 363..473
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/inference="alignment:Splign:1.39.8"
variation complement(367)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:143506945"
variation complement(374)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:376535267"
variation complement(394)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:373004342"
variation complement(395)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:369087934"
variation complement(417)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:117800198"
variation complement(429)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:184801525"
variation complement(442)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:202010748"
variation complement(452)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:377063661"
exon 474..827
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/inference="alignment:Splign:1.39.8"
variation complement(499)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:368473674"
variation complement(527)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="c"
/db_xref="dbSNP:201236389"
variation complement(532)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:375965505"
variation complement(548)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:372851416"
variation complement(570)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="c"
/db_xref="dbSNP:145343486"
variation complement(578)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="g"
/replace="t"
/db_xref="dbSNP:374361231"
variation complement(627)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="g"
/db_xref="dbSNP:150466273"
variation complement(632)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:180825092"
variation complement(671)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="g"
/replace="t"
/db_xref="dbSNP:199622423"
variation complement(672)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="g"
/db_xref="dbSNP:368154424"
variation complement(676)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="c"
/replace="t"
/db_xref="dbSNP:62001866"
variation complement(713)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="g"
/replace="t"
/db_xref="dbSNP:188310403"
variation complement(789)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="g"
/db_xref="dbSNP:373466925"
polyA_signal 808..813
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
variation complement(810..813)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace=""
/replace="taaa"
/db_xref="dbSNP:373823723"
variation complement(810..812)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace=""
/replace="taa"
/db_xref="dbSNP:138375037"
variation complement(810)
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
/replace="a"
/replace="t"
/db_xref="dbSNP:201994314"
polyA_site 827
/gene="MZB1"
/gene_synonym="MEDA-7; PACAP; pERp1"
ORIGIN
agcacacacacatctgcacctcaaccacagactacacttgctgaactggctcctggggccatgaggctgtcactgccactgctgctgctgctgctgggagcctgggccatcccagggggcctcggggacagggcgccactcacagccacagccccacaactggatgatgaggagatgtactcagcccacatgcccgctcacctgcgctgtgatgcctgcagagctgtggcttaccagatgtggcaaaatctggcaaaggcagagaccaaacttcatacctcaaactctggggggcggcgggagctgagcgagttggtctacacggatgtcctggaccggagctgctcccggaactggcaggactacggagttcgagaagtggaccaagtgaaacgtctcacaggcccaggacttagcgaggggccagagccaagcatcagcgtgatggtcacagggggcccctggcctaccaggctctccaggacatgtttgcactacttgggggagtttggagaagaccagatctatgaagcccaccaacaaggccgaggggctctggaggcattgctatgtgggggaccccagggggcctgctcagagaaggtgtcagccacaagagaagagctctagtcctggactctaccctcctctgaaagaagctggggcttgctctgacggtctccactcccgtctgcaggcagccaggagggcaggaagcccttgctctgtgctgccatcctgcctccctcctccagcctcagggcactcgggcctgggtgggagtcaacgccttcccctctggactcaaataaaacccagtgacctcaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:51237 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:51237 -> Biological process: GO:0002642 [positive regulation of immunoglobulin biosynthetic process] evidence: ISS
GeneID:51237 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:51237 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IDA
GeneID:51237 -> Biological process: GO:0008284 [positive regulation of cell proliferation] evidence: IEA
GeneID:51237 -> Biological process: GO:0030888 [regulation of B cell proliferation] evidence: ISS
GeneID:51237 -> Biological process: GO:0033622 [integrin activation] evidence: ISS
GeneID:51237 -> Biological process: GO:0042127 [regulation of cell proliferation] evidence: ISS
GeneID:51237 -> Biological process: GO:2001274 [negative regulation of glucose import in response to insulin stimulus] evidence: ISS
GeneID:51237 -> Cellular component: GO:0005576 [extracellular region] evidence: IDA
GeneID:51237 -> Cellular component: GO:0005576 [extracellular region] evidence: IEA
GeneID:51237 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:51237 -> Cellular component: GO:0005788 [endoplasmic reticulum lumen] evidence: ISS
GeneID:51237 -> Cellular component: GO:0034663 [endoplasmic reticulum chaperone complex] evidence: ISS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.