GGRNA Home | Help | Advanced search

2019-03-25 15:01:08, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_015982               1606 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens Y box binding protein 2 (YBX2), mRNA.
ACCESSION   NM_015982
VERSION     NM_015982.3  GI:156415989
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1606)
  AUTHORS   Aston,K.I., Krausz,C., Laface,I., Ruiz-Castane,E. and Carrell,D.T.
  TITLE     Evaluation of 172 candidate polymorphisms for association with
            oligozoospermia or azoospermia in a large cohort of men of European
            descent
  JOURNAL   Hum. Reprod. 25 (6), 1383-1397 (2010)
   PUBMED   20378615
  REMARK    GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   2  (bases 1 to 1606)
  AUTHORS   Hammoud,S., Emery,B.R., Dunn,D., Weiss,R.B. and Carrell,D.T.
  TITLE     Sequence alterations in the YBX2 gene are associated with male
            factor infertility
  JOURNAL   Fertil. Steril. 91 (4), 1090-1095 (2009)
   PUBMED   18339382
  REMARK    GeneRIF: A significant association between gene alterations in the
            YBX2 gene and abnormal spermatogenesis in humans, including a
            potential role in altering protamine expression, and implicate YBX2
            gene alterations as a potential cause of male factor infertility.
            GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   3  (bases 1 to 1606)
  AUTHORS   Deng,Y., Zhang,W., Su,D., Yang,Y., Ma,Y., Zhang,H. and Zhang,S.
  TITLE     Some single nucleotide polymorphisms of MSY2 gene might contribute
            to susceptibility to spermatogenic impairment in idiopathic
            infertile men
  JOURNAL   Urology 71 (5), 878-882 (2008)
   PUBMED   18372033
  REMARK    GeneRIF: some polymorphisms of the MSY2 gene might be associated
            with impaired spermatogenesis and that the gene could also be
            involved in modifying the susceptibility to idiopathic
            spermatogenic impairment in humans
            GeneRIF: Observational study of gene-disease association. (HuGE
            Navigator)
REFERENCE   4  (bases 1 to 1606)
  AUTHORS   Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A.
  TITLE     A germline-specific class of small RNAs binds mammalian Piwi
            proteins
  JOURNAL   Nature 442 (7099), 199-202 (2006)
   PUBMED   16751776
REFERENCE   5  (bases 1 to 1606)
  AUTHORS   Kohno,Y., Matsuki,Y., Tanimoto,A., Izumi,H., Uchiumi,T., Kohno,K.,
            Shimajiri,S. and Sasaguri,Y.
  TITLE     Expression of Y-box-binding protein dbpC/contrin, a potentially new
            cancer/testis antigen
  JOURNAL   Br. J. Cancer 94 (5), 710-716 (2006)
   PUBMED   16479255
  REMARK    GeneRIF: provides first evidence showing dbpC highly expressed in
            human testicular seminoma and ovarian dysgerminomas, and in
            carcinomas in other tissues and that its expression in normal
            tissues is nearly restricted to germ cells and placental
            trophoblasts
REFERENCE   6  (bases 1 to 1606)
  AUTHORS   Yoshida,T., Izumi,H., Uchiumi,T., Sasaguri,Y., Tanimoto,A.,
            Matsumoto,T., Naito,S. and Kohno,K.
  TITLE     Expression and cellular localization of dbpC/Contrin in germ cell
            tumor cell lines
  JOURNAL   Biochim. Biophys. Acta 1759 (1-2), 80-88 (2006)
   PUBMED   16624424
  REMARK    GeneRIF: transcriptional regulation of Contrin was investigated,
            and the promoter region between -272 and -253 relative to the
            transcription start site was shown to be critical for the
            manifestation of cell-type specific transcription
REFERENCE   7  (bases 1 to 1606)
  AUTHORS   Tekur,S., Pawlak,A., Guellaen,G. and Hecht,N.B.
  TITLE     Contrin, the human homologue of a germ-cell Y-box-binding protein:
            cloning, expression, and chromosomal localization
  JOURNAL   J. Androl. 20 (1), 135-144 (1999)
   PUBMED   10100484
REFERENCE   8  (bases 1 to 1606)
  AUTHORS   Gu,W., Tekur,S., Reinbold,R., Eppig,J.J., Choi,Y.C., Zheng,J.Z.,
            Murray,M.T. and Hecht,N.B.
  TITLE     Mammalian male and female germ cells express a germ cell-specific
            Y-Box protein, MSY2
  JOURNAL   Biol. Reprod. 59 (5), 1266-1274 (1998)
   PUBMED   9780336
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            DB065912.1, BC033800.1 and AI805280.1.
            On Aug 24, 2007 this sequence version replaced gi:142361318.
            
            Summary: This gene encodes a nucleic acid binding protein which is
            highly expressed in germ cells. The encoded protein binds to a
            Y-box element in the promoters of certain genes but also binds to
            mRNA transcribed from these genes. Pseudogenes for this gene are
            located on chromosome 10 and 15. [provided by RefSeq, Feb 2012].
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC047760.1, AF096834.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-37                DB065912.1         1-37
            38-1571             BC033800.1         1-1534
            1572-1606           AI805280.1         1-35                c
FEATURES             Location/Qualifiers
     source          1..1606
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17p13.1"
     gene            1..1606
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /note="Y box binding protein 2"
                     /db_xref="GeneID:51087"
                     /db_xref="HGNC:17948"
                     /db_xref="MIM:611447"
     exon            1..328
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     CDS             58..1152
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /note="germ cell specific Y-box binding protein; MSY2
                     homolog; DNA-binding protein C; germ cell-specific
                     Y-box-binding protein"
                     /codon_start=1
                     /product="Y-box-binding protein 2"
                     /protein_id="NP_057066.2"
                     /db_xref="GI:156415990"
                     /db_xref="CCDS:CCDS11098.1"
                     /db_xref="GeneID:51087"
                     /db_xref="HGNC:17948"
                     /db_xref="MIM:611447"
                     /translation="
MSEVEAAAGATAVPAATVPATAAGVVAVVVPVPAGEPQKGGGAGGGGGAASGPAAGTPSAPGSRTPGNPATAVSGTPAPPARSQADKPVLAIQVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKRNNPRKFLRSVGDGETVEFDVVEGEKGAEATNVTGPGGVPVKGSRYAPNRRKSRRFIPRPPSVAPPPMVAEIPSAGTGPGSKGERAEDSGQRPRRWCPPPFFYRRRFVRGPRPPNQQQPIEGTDRVEPKETAPLEGHQQQGDERVPPPRFRPRYRRPFRPRPRQQPTTEGGDGETKPSQGPADGSRPEPQRPRNRPYFQRRRQQAPGPQQAPGPRQPAAPETSAPVNSGDPTTTILE
"
     misc_feature    316..564
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y2T7.2);
                     Region: Required for cytoplasmic retention (By
                     similarity)"
     misc_feature    343..543
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box protein; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:88424"
     misc_feature    order(355..357,382..384,415..417,514..516)
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:88424"
     misc_feature    order(373..393,412..423)
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:88424"
     misc_feature    706..1149
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y2T7.2);
                     Region: Required for mRNA-binding"
     variation       83..84
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:11547795"
     exon            329..392
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     exon            393..426
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     exon            427..516
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     exon            517..801
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     exon            802..905
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     exon            906..1101
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     exon            1102..1191
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     exon            1192..1583
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
                     /inference="alignment:Splign:1.39.8"
     polyA_site      1572
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
     polyA_site      1583
                     /gene="YBX2"
                     /gene_synonym="CONTRIN; CSDA3; DBPC; MSY2"
ORIGIN      
gagccggggggaggggccggggcggtggcggctgtggccggtactggacccggcgggatgagcgaggtggaggcggcagcgggggctacagcggtccccgcggcgacggtgcccgcgacggcggcaggggtggtagcggtggtggtaccggtgcccgcaggggagccgcagaaaggcggcggggcgggcggcgggggcggagccgcctcgggccccgctgctgggaccccctcggcgccgggctcccgcacccctggcaatccggcgacggcggtctcgggaacccccgcccccccggcccggagtcaggcggacaagccggtgctggcaatccaagtcctgggcactgtcaaatggttcaacgtccggaatggttacggattcatcaacaggaatgacaccaaggaagatgtctttgttcaccagacagctattaaaagaaacaaccccaggaagtttctgcgcagcgttggagatggggagactgtggaatttgatgtcgtggaaggagagaagggcgcagaagccactaatgtaactgggcctgggggagtacccgtgaagggcagccgttatgcccccaaccgacgtaagtcccgccgattcatcccccggcctccctcagttgccccaccacccatggtggcagagatcccctcggcggggacaggacctggcagtaaaggggagcgggctgaagactctgggcaacggccccgacgatggtgccccccacccttcttctaccgacggcggtttgtgcgaggcccccggcctcccaaccagcagcagcctatagagggcactgacagggtagaacccaaagagacagccccattggaggggcaccaacagcagggagatgagcgagtccccccgcccagattccggcccaggtaccgaaggcctttccgccccaggccacgccagcagcctaccacagaaggtggggatggtgagaccaagcccagccaaggtcccgctgatggttcccggcctgagccccagcgcccacgaaaccgcccctacttccagcggagacggcagcaggcccctggcccccagcaggcccctggcccccggcagcccgcagcccctgagacctcagcccctgtcaacagtggggaccccaccaccaccatcctggagtgattccaactcaactcagaggacacccagagctgccatctggtatctgccagtttttccaaatgacctgtaccctacccagtaccctgctccccctttcccataattcatgacatcaaaacaccagcttttcaccttttccttgagactcaggaggaccaaagcagcagccttttgctttttcttttttcttccctccccttatcaagggttgaaggaagggagccatccttactgttcagagacagcaactccctcccgtaactcaggctgagaaggaaccagccagctcttacctcctcctggttgcttttcttgcccccaccccaagtttatttttgttttcccccggccccctacctctgaagccattttatgatctgtcatgtgccacctgagcctccagtaaaaacaaaaacaggctttcctgtggtaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:51087 -> Molecular function: GO:0003677 [DNA binding] evidence: IEA
            GeneID:51087 -> Molecular function: GO:0003682 [chromatin binding] evidence: IEA
            GeneID:51087 -> Molecular function: GO:0003730 [mRNA 3'-UTR binding] evidence: IEA
            GeneID:51087 -> Molecular function: GO:0008289 [lipid binding] evidence: IEA
            GeneID:51087 -> Molecular function: GO:0043021 [ribonucleoprotein complex binding] evidence: IEA
            GeneID:51087 -> Molecular function: GO:0045182 [translation regulator activity] evidence: IEA
            GeneID:51087 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
            GeneID:51087 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: TAS
            GeneID:51087 -> Biological process: GO:0007283 [spermatogenesis] evidence: TAS
            GeneID:51087 -> Biological process: GO:0007286 [spermatid development] evidence: IEA
            GeneID:51087 -> Biological process: GO:0009386 [translational attenuation] evidence: TAS
            GeneID:51087 -> Biological process: GO:0017148 [negative regulation of translation] evidence: IEA
            GeneID:51087 -> Biological process: GO:0048255 [mRNA stabilization] evidence: IEA
            GeneID:51087 -> Biological process: GO:0048599 [oocyte development] evidence: IEA
            GeneID:51087 -> Biological process: GO:0051100 [negative regulation of binding] evidence: IEA
            GeneID:51087 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
            GeneID:51087 -> Cellular component: GO:0005737 [cytoplasm] evidence: IEA
            GeneID:51087 -> Cellular component: GO:0005844 [polysome] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.