Home |
Help |
Advanced search
2024-04-25 10:14:31, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_014397 2645 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens NIMA-related kinase 6 (NEK6), transcript variant 2,
mRNA.
ACCESSION NM_014397
VERSION NM_014397.5 GI:261244919
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2645)
AUTHORS Cao,X., Xia,Y., Yang,J., Jiang,J., Chen,L., Ni,R., Li,L. and Gu,Z.
TITLE Clinical and biological significance of never in mitosis gene
A-related kinase 6 (NEK6) expression in hepatic cell cancer
JOURNAL Pathol. Oncol. Res. 18 (2), 201-207 (2012)
PUBMED 21725899
REMARK GeneRIF: High Nek6 is associated with hepatic cell cancer.
REFERENCE 2 (bases 1 to 2645)
AUTHORS Bertran,M.T., Sdelci,S., Regue,L., Avruch,J., Caelles,C. and
Roig,J.
TITLE Nek9 is a Plk1-activated kinase that controls early centrosome
separation through Nek6/7 and Eg5
JOURNAL EMBO J. 30 (13), 2634-2647 (2011)
PUBMED 21642957
REMARK GeneRIF: Nek9 is a Plk1-activated kinase that controls early
centrosome separation through Nek6/7 and Eg5.
Publication Status: Online-Only
REFERENCE 3 (bases 1 to 2645)
AUTHORS Jee,H.J., Kim,H.J., Kim,A.J., Song,N., Kim,M. and Yun,J.
TITLE Nek6 suppresses the premature senescence of human cancer cells
induced by camptothecin and doxorubicin treatment
JOURNAL Biochem. Biophys. Res. Commun. 408 (4), 669-673 (2011)
PUBMED 21539811
REMARK GeneRIF: These results suggest that the increased expression of
Nek6 renders cancer cells resistant to premature senescence, and
targeting Nek6 could be an efficient strategy for cancer treatment.
REFERENCE 4 (bases 1 to 2645)
AUTHORS Regue,L., Sdelci,S., Bertran,M.T., Caelles,C., Reverter,D. and
Roig,J.
TITLE DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9
JOURNAL J. Biol. Chem. 286 (20), 18118-18129 (2011)
PUBMED 21454704
REMARK GeneRIF: DYNLL/LC8 protein controls signal transduction through the
Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
REFERENCE 5 (bases 1 to 2645)
AUTHORS Meirelles,G.V., Silva,J.C., Mendonca Yde,A., Ramos,C.H.,
Torriani,I.L. and Kobarg,J.
TITLE Human Nek6 is a monomeric mostly globular kinase with an unfolded
short N-terminal domain
JOURNAL BMC Struct. Biol. 11, 12 (2011)
PUBMED 21320329
REMARK GeneRIF: the first low resolution 3D structure of hNek6 protein in
solution
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 2645)
AUTHORS Belham,C., Comb,M.J. and Avruch,J.
TITLE Identification of the NIMA family kinases NEK6/7 as regulators of
the p70 ribosomal S6 kinase
JOURNAL Curr. Biol. 11 (15), 1155-1167 (2001)
PUBMED 11516946
REFERENCE 7 (bases 1 to 2645)
AUTHORS Kimura,M. and Okano,Y.
TITLE Identification and assignment of the human NIMA-related protein
kinase 7 gene (NEK7) to human chromosome 1q31.3
JOURNAL Cytogenet. Cell Genet. 94 (1-2), 33-38 (2001)
PUBMED 11701951
REMARK GeneRIF: Also includes phylogenetic analysis and tissue-specific
RT-PCR of human NEK6 and NEK7.
REFERENCE 8 (bases 1 to 2645)
AUTHORS Kandli,M., Feige,E., Chen,A., Kilfin,G. and Motro,B.
TITLE Isolation and characterization of two evolutionarily conserved
murine kinases (Nek6 and nek7) related to the fungal mitotic
regulator, NIMA
JOURNAL Genomics 68 (2), 187-196 (2000)
PUBMED 10964517
REFERENCE 9 (bases 1 to 2645)
AUTHORS Kobayashi,T. and Cohen,P.
TITLE Activation of serum- and glucocorticoid-regulated protein kinase by
agonists that activate phosphatidylinositide 3-kinase is mediated
by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2
JOURNAL Biochem. J. 339 (PT 2), 319-328 (1999)
PUBMED 10191262
REFERENCE 10 (bases 1 to 2645)
AUTHORS Li,M.Z., Yu,L., Liu,Q., Chu,J.Y. and Zhao,S.Y.
TITLE Assignment of NEK6, a NIMA-related gene, to human chromosome 9q33.
3-->q34.11 by radiation hybrid mapping
JOURNAL Cytogenet. Cell Genet. 87 (3-4), 271-272 (1999)
PUBMED 10702691
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from CF994196.1, BC012761.2,
AL137846.24 and AF087909.1.
On Oct 10, 2009 this sequence version replaced gi:222418620.
Summary: The protein encoded by this gene is a kinase required for
progression through the metaphase portion of mitosis. Inhibition of
the encoded protein can lead to apoptosis. This protein also can
enhance tumorigenesis by suppressing tumor cell senescence. Several
transcript variants encoding a few different isoforms have been
found for this gene. [provided by RefSeq, Oct 2011].
Transcript Variant: This variant (2) differs in the 5' UTR, lacks a
portion of the 5' coding region, and initiates translation at a
downstream start codon, compared to variant 1. The encoded isoform
(2) is shorter than isoform 1. Variants 2, 5 and 6 encode the same
isoform (2).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC012761.2, AB026289.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025087, ERS025089 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-100 CF994196.1 28-127
101-894 BC012761.2 48-841
895-895 AL137846.24 13825-13825
896-1573 BC012761.2 843-1520
1574-1574 AF087909.1 1510-1510
1575-2645 BC012761.2 1522-2592
FEATURES Location/Qualifiers
source 1..2645
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="9"
/map="9q33.3-q34.11"
gene 1..2645
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="NIMA-related kinase 6"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="HPRD:05348"
/db_xref="MIM:604884"
exon 1..169
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 100
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:11556891"
variation 169
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:112601072"
exon 170..288
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 180
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:373043424"
variation 185
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:79304695"
CDS 199..1140
/gene="NEK6"
/gene_synonym="SID6-1512"
/EC_number="2.7.11.1"
/note="isoform 2 is encoded by transcript variant 2;
putative serine-threonine protein kinase;
serine/threonine-protein kinase Nek6; protein kinase
SID6-1512; nimA-related protein kinase 6; never in mitosis
A-related kinase 6; NIMA (never in mitosis gene a)-related
kinase 6"
/codon_start=1
/product="serine/threonine-protein kinase Nek6 isoform 2"
/protein_id="NP_055212.2"
/db_xref="GI:19923407"
/db_xref="CCDS:CCDS6854.1"
/db_xref="GeneID:10783"
/db_xref="HGNC:7749"
/db_xref="HPRD:05348"
/db_xref="MIM:604884"
/translation="
MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST
"
misc_feature 199..330
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9HC98.2);
Region: Interaction with ARHGAP33, ANKRA2, CDC42, PRDX3,
RAD26L, RBBP6, RPS7 and TRIP4"
misc_feature 307..309
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(Q9HC98.2); phosphorylation site"
misc_feature 322..1119
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Catalytic domain of the Protein Serine/Threonine
Kinases, Never In Mitosis gene A-related kinase 6 and 7;
Region: STKc_Nek6_Nek7; cd08224"
/db_xref="CDD:173764"
misc_feature 331..1128
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature order(349..363,373..375,412..414,418..420,514..516,
562..573,583..585,589..591,712..714,718..720,724..729,
733..735,766..768,775..777,781..783,823..834)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="active site"
/db_xref="CDD:173764"
misc_feature order(349..354,358..363,373..375,412..414,418..420,
514..516,565..573,583..585,727..729,733..735,781..783)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173764"
misc_feature order(361..363,583..585,589..591,712..714,718..720,
724..726,775..777,823..834)
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173764"
misc_feature 520..522
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Autoinhibitory; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); other site"
misc_feature 763..834
/gene="NEK6"
/gene_synonym="SID6-1512"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173764"
misc_feature 802..804
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 814..816
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by NEK9; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 814..816
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:11386"
misc_feature 826..828
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (Q9HC98.2); phosphorylation site"
misc_feature 997..1008
/gene="NEK6"
/gene_synonym="SID6-1512"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (Q9HC98.2);
Region: Interaction with APBB1"
variation 227
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:377403028"
variation 246
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:145488745"
variation 255
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:35882196"
variation 274
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140978005"
exon 289..429
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 303
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:116276253"
variation 326
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:183673274"
variation 340
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:148262318"
exon 430..492
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 447
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:141841414"
variation 459
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200803888"
variation 468
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:150614386"
variation 473
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:183711992"
exon 493..603
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 495
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:138847171"
variation 507
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:199829118"
variation 531
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186179243"
variation 539
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:370008827"
variation 547
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:143094065"
variation 549
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:115563387"
exon 604..712
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 631
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:11556892"
variation 632
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:368466543"
variation 633
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:372516510"
variation 645
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:375715210"
variation 671
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200565078"
variation 681
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201692889"
variation 694
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:369950028"
exon 713..820
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 750
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:147517890"
variation 775
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140109985"
variation 783
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144636007"
variation 785
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="g"
/replace="t"
/db_xref="dbSNP:200086787"
variation 789
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:201207004"
variation 804
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:145520134"
exon 821..915
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 882
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:144397688"
variation 888
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:201833354"
variation 895
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:10760354"
variation 912
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:200895433"
exon 916..1029
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 939
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:142081750"
variation 954
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:151138282"
variation 978
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191153129"
variation 1008
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201681080"
variation 1023
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:140302963"
variation 1024
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:144052872"
exon 1030..2635
/gene="NEK6"
/gene_synonym="SID6-1512"
/inference="alignment:Splign:1.39.8"
variation 1034
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200398623"
variation 1049
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:201113183"
variation 1069
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:146443565"
variation 1092
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375270617"
variation 1093
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200235098"
variation 1099
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:376476122"
variation 1104
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141017419"
variation 1113
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:200021823"
variation 1142
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:370917966"
variation 1153
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:375568776"
STS 1154..1304
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11482"
/db_xref="UniSTS:58088"
variation 1154
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:201649447"
variation 1257..1258
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="c"
/db_xref="dbSNP:36107117"
variation 1343
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:138529813"
STS 1365..1625
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH12239"
/db_xref="UniSTS:63110"
variation 1479
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:187874166"
STS 1484..1633
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="SGC33089"
/db_xref="UniSTS:78220"
variation 1515
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:190024004"
variation 1516
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:142713923"
variation 1528
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:58099088"
variation 1574
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:2416"
variation 1583..1584
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace=""
/replace="tcaa"
/db_xref="dbSNP:374990567"
variation 1642
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:146937021"
variation 1644
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:77933598"
variation 1646
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:12555646"
variation 1703
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:182662225"
variation 1715
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:147972018"
variation 1737
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:186630550"
variation 1824
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:191474528"
variation 1844
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185386620"
variation 1884
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:141687734"
variation 1954
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:28687204"
variation 2005
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:11556890"
variation 2041
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:189086459"
STS 2113..2246
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH77983"
/db_xref="UniSTS:226"
variation 2182
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:192831011"
variation 2223
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:150524435"
variation 2232
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="t"
/db_xref="dbSNP:139595461"
variation 2237
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="g"
/db_xref="dbSNP:76125733"
STS 2331..2568
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="RH11599"
/db_xref="UniSTS:61308"
STS 2354..2627
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="A006A17"
/db_xref="UniSTS:68860"
STS 2354..2627
/gene="NEK6"
/gene_synonym="SID6-1512"
/standard_name="G20648"
/db_xref="UniSTS:68859"
variation 2383
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:371394348"
variation 2397
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:146280734"
variation 2403
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:13467"
variation 2405
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="c"
/replace="t"
/db_xref="dbSNP:185361860"
variation 2485
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="c"
/db_xref="dbSNP:377058344"
variation 2536
/gene="NEK6"
/gene_synonym="SID6-1512"
/replace="a"
/replace="g"
/db_xref="dbSNP:189170661"
polyA_signal 2586..2591
/gene="NEK6"
/gene_synonym="SID6-1512"
polyA_site 2635
/gene="NEK6"
/gene_synonym="SID6-1512"
ORIGIN
gggcgggcgcgcgggcgcgcgggcccgcgcaggcggtggcggcggcggcggaaccgagctgacgggcgtgcggccgctgcgccgcaaactcgtgtgggacgcaccgctccagccgcccgcgggccagcgcaccggtcccccagcggcagccgagcccgcccgcgcgccgttcgtgccctcgtgaggctggcatgcaggatggcaggacagcccggccacatgccccatggagggagttccaacaacctctgccacaccctggggcctgtgcatcctcctgacccacagaggcatcccaacacgctgtcttttcgctgctcgctggcggacttccagatcgaaaagaagataggccgaggacagttcagcgaggtgtacaaggccacctgcctgctggacaggaagacagtggctctgaagaaggtgcagatctttgagatgatggacgccaaggcgaggcaggactgtgtcaaggagatcggcctcttgaagcaactgaaccacccaaatatcatcaagtatttggactcgtttatcgaagacaacgagctgaacattgtgctggagttggctgacgcaggggacctctcgcagatgatcaagtactttaagaagcagaagcggctcatcccggagaggacagtatggaagtactttgtgcagctgtgcagcgccgtggagcacatgcattcacgccgggtgatgcaccgagacatcaagcctgccaacgtgttcatcacagccacgggcgtcgtgaagctcggtgaccttggtctgggccgcttcttcagctctgagaccaccgcagcccactccctagtggggacgccctactacatgtcaccggagaggatccatgagaacggctacaacttcaagtccgacatctggtccctgggctgtctgctgtacgagatggcagccctccagagccccttctatggagataagatgaatctcttctccctgtgccagaagatcgagcagtgtgactaccccccactccccggggagcactactccgagaagttacgagaactggtcagcatgtgcatctgccctgacccccaccagagacctgacatcggatacgtgcaccaggtggccaagcagatgcacatctggatgtccagcacctgagcgtggatgcaccgtgccttatcaaagccagcaccactttgccttacttgagtcgtcttctcttcgagtggccacctggtagcctagaacagctaagaccacagggttcagcaggttccccaaaaggctgcccagccttacagcagatgctgaaggcagagcagctgagggaggggcgctggccacatgtcactgatggtcagattccaaagtcctttctttatactgttgtggacaatctcagctgggtcaataagggcaggtggttcagcgagccacggcagccccctgtatctggattgtaatgtgaatctttagggtaattcctccagtgacctgtcaaggcttatgctaacaggagacttgcaggagaccgtgtgatttgtgtagtgagcctttgaaaatggttagtaccgggttcagtttagttcttagtatcttttcaatcaagctgtgtgcttaatttactctgttgtaaagggataaagtggaaatcatttttttccgtggagtggtgattctgctaacatttttatctacgttttataacttggtgagtgacgatgagagccctgcacctggccagagtgtcacaggcaaaaggcatcgggaagcaggagcatcttcttggcagccaggctgggccatcttctcctggacacctgctgtgtaccaggaacttcgtcacctccttgaatgctggcggttcatttcatgatcagtgttaagcattttcctccatgggaaggaagcatgggatatagaaaagcgaagggctgtcctttacaaattctggttctgcaacttcctagcgtgactttgggcttgggcaagtttcttagccgttctgagccttcatttcctcatctgtacaatgagattaatagtacctatcatctaccttcaggattgctgacagacagaatttgaaataaaatatgcaagttagctaatacaaaaagtagatgatccaaaaatggtagccactcacccttcacaaactgaagtccatggaccacggaagtcgagaattaatgtacacctgtatcatgtgtaggaaaccagaaatgtgttccttatttcttgttcccaaacaggattaactgtgaagactaatttataaatgtgaacctaagaaaactccacctctgaaggaaatcatttgaattttgtttttgtacgtaaagttaaccttccaattgtctgagctgtcgtcactgacttcatgacagtctggccctccagacaagagcagcgctggcatcgggcaggtgattcctgacacctgctgcctgcaggcattcactgaccaggcctttcctggaggaaacacccagggccgggcggctgctgtttccacacgtggactcggatctgctgtgacaccgtcagcccgacagtctctccatatgcagcctttcctctgtacttttctccatggttgaaataaaacagggtgactgggagttacttagaattcatgaagattttaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10783 -> Molecular function: GO:0000287 [magnesium ion binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IDA
GeneID:10783 -> Molecular function: GO:0004871 [signal transducer activity] evidence: IMP
GeneID:10783 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0005524 [ATP binding] evidence: IDA
GeneID:10783 -> Molecular function: GO:0019894 [kinesin binding] evidence: IPI
GeneID:10783 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IPI
GeneID:10783 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0000910 [cytokinesis] evidence: TAS
GeneID:10783 -> Biological process: GO:0006468 [protein phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10783 -> Biological process: GO:0007059 [chromosome segregation] evidence: IDA
GeneID:10783 -> Biological process: GO:0007067 [mitosis] evidence: IEA
GeneID:10783 -> Biological process: GO:0007077 [mitotic nuclear envelope disassembly] evidence: TAS
GeneID:10783 -> Biological process: GO:0007165 [signal transduction] evidence: IMP
GeneID:10783 -> Biological process: GO:0007346 [regulation of mitotic cell cycle] evidence: TAS
GeneID:10783 -> Biological process: GO:0018105 [peptidyl-serine phosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0030071 [regulation of mitotic metaphase/anaphase transition] evidence: IDA
GeneID:10783 -> Biological process: GO:0031572 [G2 DNA damage checkpoint] evidence: IMP
GeneID:10783 -> Biological process: GO:0043123 [positive regulation of I-kappaB kinase/NF-kappaB cascade] evidence: IMP
GeneID:10783 -> Biological process: GO:0046777 [protein autophosphorylation] evidence: IDA
GeneID:10783 -> Biological process: GO:0051225 [spindle assembly] evidence: TAS
GeneID:10783 -> Biological process: GO:2000772 [regulation of cellular senescence] evidence: TAS
GeneID:10783 -> Cellular component: GO:0000922 [spindle pole] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:10783 -> Cellular component: GO:0005815 [microtubule organizing center] evidence: IEA
GeneID:10783 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:10783 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
GeneID:10783 -> Cellular component: GO:0016607 [nuclear speck] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_055212 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.