Home |
Help |
Advanced search
2024-04-25 19:38:57, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_013371 1848 bp mRNA linear PRI 15-JUN-2013
DEFINITION Homo sapiens interleukin 19 (IL19), transcript variant 2, mRNA.
ACCESSION NM_013371
VERSION NM_013371.3 GI:315467847
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1848)
AUTHORS Kordi-Tamandani,D.M., Sadeghi-Bojd,S. and Torkamanzehi,A.
TITLE IL-19 and IL-20 genes polymorphisms and haplotype analysis in a
vesicoureteral reflux population
JOURNAL Hum. Immunol. 74 (1), 131-134 (2013)
PUBMED 23000500
REMARK GeneRIF: A significant association was found between the combined
genotypes of IL19GC + CC and IL20TG + GG and increased risk of
vesicoureteral reflux.
REFERENCE 2 (bases 1 to 1848)
AUTHORS Jostins,L., Ripke,S., Weersma,R.K., Duerr,R.H., McGovern,D.P.,
Hui,K.Y., Lee,J.C., Schumm,L.P., Sharma,Y., Anderson,C.A.,
Essers,J., Mitrovic,M., Ning,K., Cleynen,I., Theatre,E.,
Spain,S.L., Raychaudhuri,S., Goyette,P., Wei,Z., Abraham,C.,
Achkar,J.P., Ahmad,T., Amininejad,L., Ananthakrishnan,A.N.,
Andersen,V., Andrews,J.M., Baidoo,L., Balschun,T., Bampton,P.A.,
Bitton,A., Boucher,G., Brand,S., Buning,C., Cohain,A., Cichon,S.,
D'Amato,M., De Jong,D., Devaney,K.L., Dubinsky,M., Edwards,C.,
Ellinghaus,D., Ferguson,L.R., Franchimont,D., Fransen,K.,
Gearry,R., Georges,M., Gieger,C., Glas,J., Haritunians,T., Hart,A.,
Hawkey,C., Hedl,M., Hu,X., Karlsen,T.H., Kupcinskas,L.,
Kugathasan,S., Latiano,A., Laukens,D., Lawrance,I.C., Lees,C.W.,
Louis,E., Mahy,G., Mansfield,J., Morgan,A.R., Mowat,C., Newman,W.,
Palmieri,O., Ponsioen,C.Y., Potocnik,U., Prescott,N.J.,
Regueiro,M., Rotter,J.I., Russell,R.K., Sanderson,J.D., Sans,M.,
Satsangi,J., Schreiber,S., Simms,L.A., Sventoraityte,J.,
Targan,S.R., Taylor,K.D., Tremelling,M., Verspaget,H.W., De Vos,M.,
Wijmenga,C., Wilson,D.C., Winkelmann,J., Xavier,R.J., Zeissig,S.,
Zhang,B., Zhang,C.K., Zhao,H., Silverberg,M.S., Annese,V.,
Hakonarson,H., Brant,S.R., Radford-Smith,G., Mathew,C.G.,
Rioux,J.D., Schadt,E.E., Daly,M.J., Franke,A., Parkes,M.,
Vermeire,S., Barrett,J.C. and Cho,J.H.
CONSRTM International IBD Genetics Consortium (IIBDGC)
TITLE Host-microbe interactions have shaped the genetic architecture of
inflammatory bowel disease
JOURNAL Nature 491 (7422), 119-124 (2012)
PUBMED 23128233
REFERENCE 3 (bases 1 to 1848)
AUTHORS Pace,E., Scafidi,V., Di Bona,D., Siena,L., Chiappara,G.,
Ferraro,M., La Grutta,S., Gallina,S., Speciale,R., Ballacchino,A.,
Bachert,C., Bousquet,J. and Gjomarkaj,M.
TITLE Increased expression of IL-19 in the epithelium of patients with
chronic rhinosinusitis and nasal polyps
JOURNAL Allergy 67 (7), 878-886 (2012)
PUBMED 22583192
REMARK GeneRIF: IL-19 is overexpressed in the epithelium in Chronic
rhinosinusitis with nasal polyps and increases epithelial cell
proliferation.
REFERENCE 4 (bases 1 to 1848)
AUTHORS Hsing,C.H., Cheng,H.C., Hsu,Y.H., Chan,C.H., Yeh,C.H., Li,C.F. and
Chang,M.S.
TITLE Upregulated IL-19 in breast cancer promotes tumor progression and
affects clinical outcome
JOURNAL Clin. Cancer Res. 18 (3), 713-725 (2012)
PUBMED 22186257
REMARK GeneRIF: IL-19 is pivotal in the pathogenesis of breast cancer.
REFERENCE 5 (bases 1 to 1848)
AUTHORS Gabunia,K., Ellison,S.P., Singh,H., Datta,P., Kelemen,S.E.,
Rizzo,V. and Autieri,M.V.
TITLE Interleukin-19 (IL-19) induces heme oxygenase-1 (HO-1) expression
and decreases reactive oxygen species in human vascular smooth
muscle cells
JOURNAL J. Biol. Chem. 287 (4), 2477-2484 (2012)
PUBMED 22158875
REMARK GeneRIF: Interleukin-19 (IL-19) induces heme oxygenase-1 (HO-1)
expression and decreases reactive oxygen species in human vascular
smooth muscle cells.
REFERENCE 6 (bases 1 to 1848)
AUTHORS Wolk,K., Kunz,S., Asadullah,K. and Sabat,R.
TITLE Cutting edge: immune cells as sources and targets of the IL-10
family members?
JOURNAL J. Immunol. 168 (11), 5397-5402 (2002)
PUBMED 12023331
REFERENCE 7 (bases 1 to 1848)
AUTHORS Fickenscher,H., Hor,S., Kupers,H., Knappe,A., Wittmann,S. and
Sticht,H.
TITLE The interleukin-10 family of cytokines
JOURNAL Trends Immunol. 23 (2), 89-96 (2002)
PUBMED 11929132
REFERENCE 8 (bases 1 to 1848)
AUTHORS Dumoutier,L., Leemans,C., Lejeune,D., Kotenko,S.V. and Renauld,J.C.
TITLE Cutting edge: STAT activation by IL-19, IL-20 and mda-7 through
IL-20 receptor complexes of two types
JOURNAL J. Immunol. 167 (7), 3545-3549 (2001)
PUBMED 11564763
REFERENCE 9 (bases 1 to 1848)
AUTHORS Blumberg,H., Conklin,D., Xu,W.F., Grossmann,A., Brender,T.,
Carollo,S., Eagan,M., Foster,D., Haldeman,B.A., Hammond,A.,
Haugen,H., Jelinek,L., Kelly,J.D., Madden,K., Maurer,M.F.,
Parrish-Novak,J., Prunkard,D., Sexson,S., Sprecher,C., Waggie,K.,
West,J., Whitmore,T.E., Yao,L., Kuechle,M.K., Dale,B.A. and
Chandrasekher,Y.A.
TITLE Interleukin 20: discovery, receptor identification, and role in
epidermal function
JOURNAL Cell 104 (1), 9-19 (2001)
PUBMED 11163236
REFERENCE 10 (bases 1 to 1848)
AUTHORS Gallagher,G., Dickensheets,H., Eskdale,J., Izotova,L.S.,
Mirochnitchenko,O.V., Peat,J.D., Vazquez,N., Pestka,S.,
Donnelly,R.P. and Kotenko,S.V.
TITLE Cloning, expression and initial characterization of interleukin-19
(IL-19), a novel homologue of human interleukin-10 (IL-10)
JOURNAL Genes Immun. 1 (7), 442-450 (2000)
PUBMED 11196675
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AF453946.1, AL513315.15 and
CA306526.1.
On Dec 24, 2010 this sequence version replaced gi:30795207.
Summary: The protein encoded by this gene is a cytokine that
belongs to the IL10 cytokine subfamily. This cytokine is found to
be preferentially expressed in monocytes. It can bind the IL20
receptor complex and lead to the activation of the signal
transducer and activator of transcription 3 (STAT3). A similar
cytokine in mouse is reported to up-regulate the expression of IL6
and TNF-alpha and induce apoptosis, which suggests a role of this
cytokine in inflammatory responses. Alternatively spliced
transcript variants encoding the distinct isoforms have been
described. [provided by RefSeq, Jul 2008].
Transcript Variant: This variant (2) lacks an exon from the 5' end
and contains two alternate 5' exons, resulting in a downstream AUG
start codon, as compared to variant 1. The resulting isoform (2)
has a shorter N-terminus, as compared to isoform 1.
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF453946.1 [ECO:0000332]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-832 AF453946.1 1-832
833-937 AL513315.15 68772-68876
938-1462 AF453946.1 938-1462
1463-1731 AL513315.15 77088-77356
1732-1848 CA306526.1 1-117 c
FEATURES Location/Qualifiers
source 1..1848
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q32.2"
gene 1..1848
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/note="interleukin 19"
/db_xref="GeneID:29949"
/db_xref="HGNC:5990"
/db_xref="MIM:605687"
exon 1..250
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/inference="alignment:Splign:1.39.8"
variation 58
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="c"
/db_xref="dbSNP:76136426"
variation 115
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:74995542"
variation 135..137
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace=""
/replace="t"
/db_xref="dbSNP:5780365"
variation 154..155
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace=""
/replace="t"
/replace="tt"
/db_xref="dbSNP:34996858"
variation 157
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:12145739"
variation 190
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:141983177"
exon 251..937
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/inference="alignment:Splign:1.39.8"
variation 309
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:79769796"
variation 468
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:181139506"
variation 491
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="c"
/db_xref="dbSNP:36214464"
variation 587..588
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace=""
/replace="g"
/db_xref="dbSNP:35320904"
variation 640
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:57750293"
variation 784
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2243157"
variation 799
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:189950739"
variation 833
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:2243158"
variation 887
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:59192988"
misc_feature 895..897
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/note="upstream in-frame stop codon"
variation 919
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:140996977"
exon 938..1083
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/inference="alignment:Splign:1.39.8"
CDS 940..1473
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/note="isoform 2 precursor is encoded by transcript
variant 2; melanoma differentiation associated
protein-like protein; interleukin-19; melanoma
differentiation-associated protein-like protein"
/codon_start=1
/product="interleukin-19 isoform 2 precursor"
/protein_id="NP_037503.2"
/db_xref="GI:30795208"
/db_xref="CCDS:CCDS1469.1"
/db_xref="GeneID:29949"
/db_xref="HGNC:5990"
/db_xref="MIM:605687"
/translation="
MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSA
"
sig_peptide 940..1011
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
mat_peptide 1012..1470
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/product="interleukin-19 isoform 2"
misc_feature 1036..1440
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/note="Il-24-like protein; Provisional; Region: PHA02839"
/db_xref="CDD:165182"
variation 1004
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:149618619"
variation 1008
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:374799009"
variation 1009
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:367592655"
variation 1082
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372374877"
exon 1084..1149
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/inference="alignment:Splign:1.39.8"
exon 1150..1302
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/inference="alignment:Splign:1.39.8"
variation 1161
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:114150539"
variation 1168
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:375138273"
variation 1179
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:141660098"
variation 1194
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:143520689"
variation 1206
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:139186391"
variation 1215
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372615212"
exon 1303..1377
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/inference="alignment:Splign:1.39.8"
exon 1378..1832
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/inference="alignment:Splign:1.39.8"
variation 1390
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:375976152"
variation 1420
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:144719259"
variation 1463
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:2243191"
variation 1465
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:370571915"
variation 1483
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:372603560"
variation 1488
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:182270228"
variation 1520
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:186540222"
variation 1521
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="g"
/replace="t"
/db_xref="dbSNP:371050229"
variation 1542
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2243199"
STS 1545..1683
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/standard_name="SHGC-76229"
/db_xref="UniSTS:47631"
variation 1565..1566
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace=""
/replace="g"
/db_xref="dbSNP:34781544"
variation 1605
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:192244887"
variation 1606
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:141651248"
variation 1619
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2243192"
variation 1631
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:1798"
variation 1651
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:188753494"
variation 1665
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="t"
/db_xref="dbSNP:372576952"
variation 1731
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="a"
/replace="g"
/db_xref="dbSNP:2243193"
variation 1768
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
/replace="c"
/replace="g"
/db_xref="dbSNP:2980285"
polyA_signal 1807..1812
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
polyA_site 1832
/gene="IL19"
/gene_synonym="IL-10C; MDA1; NG.1; ZMDA1"
ORIGIN
gctggagtgcaatggtgaaattatagcagactgcagtcttcaactcctgacctcaagcaattgtcctgcctcctcaacttcctgactacaggtgtgcatgaggactacaggcaggcatgtgccaacacatgcagctttttttttttttttttttcagagatgtggtctcgctttgttgcctacactggtctcaaactcttggcctcaagggatcctcccacctcggcttcccaaagtgcagagattacagtctcattttctctctctctgcattaatcaagaatgagagaaccctccaggggacaagatgaaggggaaatagatgatgtgcaaagaaatccttgctttatgaggggaaaaagtgttcctcatgaagttcaacaaaatgatgcaggtaaagcagttagctagcacctggcacatggcagacactcatagctgcctaaggcattggagaactggatcgtgctgcagccagaggcacctgcagagcctcatgggctggctgctgcagggtgtggctgattgagagtgcttttgtgagttggcctgcagggtacacttggtaacgtgccacagctctcaggaaagtgacctaagttggatttttctgcatggacatagaattgcaaaaaattctcatttgcatggagatggggagtttatttttcctagaagctgcatgtcaagacccagaagaaagaggcatttcataataatgattaatcagctatatcttaaagaagaaagaaaacaattaaggaaatacaatactaagaaaacaaggggaaaaaacaatctccccaaggtggatccacccagcaaaccttgacagcatttcctcttatccacctgaataaaaatgaccagccctttccaaatggcagagagcactgagaggagacacaaggagcagcccgcaagcaccaagtgagaggcatgaagttacagtgtgtttccctttggctcctgggtacaatactgatattgtgctcagtagacaaccacggtctcaggagatgtctgatttccacagacatgcaccatatagaagagagtttccaagaaatcaaaagagccatccaagctaaggacaccttcccaaatgtcactatcctgtccacattggagactctgcagatcattaagcccttagatgtgtgctgcgtgaccaagaacctcctggcgttctacgtggacagggtgttcaaggatcatcaggagccaaaccccaaaatcttgagaaaaatcagcagcattgccaactctttcctctacatgcagaaaactctgcggcaatgtcaggaacagaggcagtgtcactgcaggcaggaagccaccaatgccaccagagtcatccatgacaactatgatcagctggaggtccacgctgctgccattaaatccctgggagagctcgacgtctttctagcctggattaataagaatcatgaagtaatgttctcagcttgatgacaaggaacctgtatagtgatccagggatgaacaccccctgtgcggtttactgtgggagacagcccaccttgaaggggaaggagatggggaaggccccttgcagctgaaagtcccactggctggcctcaggctgtcttattccgcttgaaaatagccaaaaagtctactgtggtatttgtaataaactctatctgctgaaagggcctgcaggccatcctgggagtaaagggctgccttcccatctaatttattgtaaagtcatatagtccatgtctgtgatgtgagccaagtgatatcctgtagtacacattgtactgagtggtttttctgaataaattccatattttacctatgaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:29949 -> Molecular function: GO:0005125 [cytokine activity] evidence: TAS
GeneID:29949 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:29949 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IEA
GeneID:29949 -> Biological process: GO:0006955 [immune response] evidence: NAS
GeneID:29949 -> Biological process: GO:0007165 [signal transduction] evidence: NAS
GeneID:29949 -> Biological process: GO:0042226 [interleukin-6 biosynthetic process] evidence: IEA
GeneID:29949 -> Biological process: GO:0072593 [reactive oxygen species metabolic process] evidence: IEA
GeneID:29949 -> Cellular component: GO:0005576 [extracellular region] evidence: NAS
GeneID:29949 -> Cellular component: GO:0005615 [extracellular space] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.