GGRNA Home | Help | Advanced search

2024-03-29 19:50:45, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_013260               2519 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens SAP30 binding protein (SAP30BP), mRNA.
ACCESSION   NM_013260
VERSION     NM_013260.6  GI:156071507
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2519)
  AUTHORS   Xu,B., Roos,J.L., Dexheimer,P., Boone,B., Plummer,B., Levy,S.,
            Gogos,J.A. and Karayiorgou,M.
  TITLE     Exome sequencing supports a de novo mutational paradigm for
            schizophrenia
  JOURNAL   Nat. Genet. 43 (9), 864-868 (2011)
   PUBMED   21822266
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2519)
  AUTHORS   Chen,J., Li,Y.M., Li,J.F., Liu,L.D., Liao,Y., Na,R.X., Wang,J.J.,
            Wang,L.C. and Li,Q.H.
  TITLE     Transcriptional regulation by HSV-1 induced HTRP via acetylation
            system
  JOURNAL   Virol Sin 25 (6), 417-424 (2010)
   PUBMED   21221920
  REMARK    GeneRIF: The results indicate that HTRP could inhibit the
            transcription of a viral promoter, whose interaction with SAP30
            synergistically affects transcriptional inhibition of the herpes
            simplex virus type 1 genes, and is related to HDAC enzyme activity.
REFERENCE   3  (bases 1 to 2519)
  AUTHORS   Naukkarinen,J., Surakka,I., Pietilainen,K.H., Rissanen,A.,
            Salomaa,V., Ripatti,S., Yki-Jarvinen,H., van Duijn,C.M.,
            Wichmann,H.E., Kaprio,J., Taskinen,M.R. and Peltonen,L.
  CONSRTM   ENGAGE Consortium
  TITLE     Use of genome-wide expression data to mine the 'Gray Zone' of GWA
            studies leads to novel candidate obesity genes
  JOURNAL   PLoS Genet. 6 (6), E1000976 (2010)
   PUBMED   20532202
  REMARK    GeneRIF: Observational study and genome-wide association study of
            gene-disease association. (HuGE Navigator)
            Publication Status: Online-Only
REFERENCE   4  (bases 1 to 2519)
  AUTHORS   Gao,J., Li,W.X., Feng,S.Q., Yuan,Y.S., Wan,D.F., Han,W. and Yu,Y.
  TITLE     A protein-protein interaction network of transcription factors
            acting during liver cell proliferation
  JOURNAL   Genomics 91 (4), 347-355 (2008)
   PUBMED   18255255
REFERENCE   5  (bases 1 to 2519)
  AUTHORS   Li,J.F., Liu,L.D., Ma,S.H., Che,Y.C., Wang,L.C., Dong,C.H.,
            Zhao,H.L., Liao,Y. and Li,Q.H.
  TITLE     HTRP--an immediate-early gene product induced by HSV1 infection in
            human embryo fibroblasts, is involved in cellular co-repressors
  JOURNAL   J. Biochem. 136 (2), 169-176 (2004)
   PUBMED   15496587
  REMARK    GeneRIF: HTRP is involved in cellular co-repressors
REFERENCE   6  (bases 1 to 2519)
  AUTHORS   Hu,R.M., Han,Z.G., Song,H.D., Peng,Y.D., Huang,Q.H., Ren,S.X.,
            Gu,Y.J., Huang,C.H., Li,Y.B., Jiang,C.L., Fu,G., Zhang,Q.H.,
            Gu,B.W., Dai,M., Mao,Y.F., Gao,G.F., Rong,R., Ye,M., Zhou,J.,
            Xu,S.H., Gu,J., Shi,J.X., Jin,W.R., Zhang,C.K., Wu,T.M.,
            Huang,G.Y., Chen,Z., Chen,M.D. and Chen,J.L.
  TITLE     Gene expression profiling in the human
            hypothalamus-pituitary-adrenal axis and full-length cDNA cloning
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 97 (17), 9543-9548 (2000)
   PUBMED   10931946
REFERENCE   7  (bases 1 to 2519)
  AUTHORS   Zhang,Y., Sun,Z.W., Iratni,R., Erdjument-Bromage,H., Tempst,P.,
            Hampsey,M. and Reinberg,D.
  TITLE     SAP30, a novel protein conserved between human and yeast, is a
            component of a histone deacetylase complex
  JOURNAL   Mol. Cell 1 (7), 1021-1031 (1998)
   PUBMED   9651585
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC087749.12.
            On Aug 16, 2007 this sequence version replaced gi:47834346.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC030233.1, AY082382.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-160               AC087749.12        111805-111964
            161-270             AC087749.12        113002-113111
            271-318             AC087749.12        116302-116349
            319-361             AC087749.12        137926-137968
            362-450             AC087749.12        144269-144357
            451-542             AC087749.12        146966-147057
            543-603             AC087749.12        147797-147857
            604-655             AC087749.12        148294-148345
            656-714             AC087749.12        149242-149300
            715-799             AC087749.12        150494-150578
            800-2519            AC087749.12        150826-152545
FEATURES             Location/Qualifiers
     source          1..2519
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="17"
                     /map="17q25.1"
     gene            1..2519
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /note="SAP30 binding protein"
                     /db_xref="GeneID:29115"
                     /db_xref="HGNC:30785"
                     /db_xref="HPRD:17094"
                     /db_xref="MIM:610218"
     exon            1..160
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       20
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370904087"
     variation       27
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:375315996"
     variation       50
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368616539"
     CDS             55..981
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /note="HSV-1 binding; transcriptional regulator protein
                     HCNGP"
                     /codon_start=1
                     /product="SAP30-binding protein"
                     /protein_id="NP_037392.1"
                     /db_xref="GI:9994179"
                     /db_xref="CCDS:CCDS11726.1"
                     /db_xref="GeneID:29115"
                     /db_xref="HGNC:30785"
                     /db_xref="HPRD:17094"
                     /db_xref="MIM:610218"
                     /translation="
MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ
"
     misc_feature    106..108
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9UHR5.1); phosphorylation site"
     misc_feature    118..120
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9UHR5.1); phosphorylation site"
     misc_feature    181..183
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9UHR5.1); phosphorylation site"
     misc_feature    208..210
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9UHR5.1); phosphorylation site"
     misc_feature    391..393
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
                     (Q9UHR5.1); phosphorylation site"
     misc_feature    409..699
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /note="HCNGP-like protein; Region: HCNGP; pfam07818"
                     /db_xref="CDD:191863"
     variation       80
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201680665"
     variation       81
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375395105"
     variation       99
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372925697"
     variation       126
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:8071553"
     exon            161..270
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       161
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111336734"
     variation       163
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367727956"
     variation       167
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199944352"
     variation       180
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138151640"
     variation       269
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200034773"
     exon            271..318
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       280
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374805218"
     variation       293
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:141727230"
     exon            319..361
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       319
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373126274"
     variation       341
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150596591"
     variation       357
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139608518"
     exon            362..450
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       392
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370083040"
     variation       393
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373834045"
     variation       403
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368000997"
     variation       423
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113668113"
     variation       439
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11558668"
     exon            451..542
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       462
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376697317"
     exon            543..603
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       572
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146045832"
     exon            604..655
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       623
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140022461"
     variation       629
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184496853"
     exon            656..714
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       706
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372381855"
     exon            715..799
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       735
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187342769"
     variation       738
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374730171"
     variation       753
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376398113"
     variation       760
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143739015"
     variation       762
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56144802"
     variation       772..774
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace=""
                     /replace="act"
                     /db_xref="dbSNP:372648052"
     exon            800..2519
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /inference="alignment:Splign:1.39.8"
     variation       831
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148987774"
     variation       854
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200708050"
     variation       872
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373102942"
     variation       890
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201392633"
     variation       936
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140985854"
     variation       960
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376325673"
     variation       982
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377404831"
     variation       984
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143414711"
     variation       985
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200431565"
     variation       988
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199634823"
     variation       990
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146566382"
     STS             1055..1212
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /standard_name="RH18255"
                     /db_xref="UniSTS:17514"
     variation       1077
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369889672"
     variation       1192
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182731847"
     variation       1359
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16968216"
     STS             1388..1541
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /standard_name="RH17466"
                     /db_xref="UniSTS:9256"
     variation       1446
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377376763"
     variation       1560..1563
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace=""
                     /replace="cacc"
                     /db_xref="dbSNP:376979689"
     variation       1576
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:28562909"
     variation       1687
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370361692"
     variation       1696
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149170453"
     variation       1726..1728
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace=""
                     /replace="cct"
                     /db_xref="dbSNP:72233484"
     variation       1739
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374711763"
     variation       1740
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143212085"
     variation       1747
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188077540"
     variation       1768
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:191551152"
     variation       1825
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375147206"
     variation       1895
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376525684"
     variation       2024
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115467173"
     variation       2101
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370978777"
     variation       2197
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374244975"
     variation       2203
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140465078"
     variation       2241
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182922408"
     variation       2325
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115541056"
     variation       2343
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372366921"
     variation       2355
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1063092"
     STS             2370..2470
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /standard_name="Cda12b04"
                     /db_xref="UniSTS:68883"
     variation       2373
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1063093"
     variation       2407
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187220320"
     variation       2424
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1063094"
     variation       2437
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1063095"
     variation       2469
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1063096"
     variation       2475
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1046554"
     variation       2486
                     /gene="SAP30BP"
                     /gene_synonym="HCNGP; HTRG; HTRP"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:192084264"
ORIGIN      
gaagtcggcgtcttgagtcataggagtgagccacgcccgggctgtgggaataagatggcggggaagaagaatgttctgtcgtctctcgcagtttacgcggaagattcagagcccgagtctgatggcgaggctggaatcgaggcggtgggcagcgcggctgaggagaaaggcggattggtatctgatgcctatggggaggatgacttttctcgtctagggggtgatgaagatggttatgaagaagaagaagatgagaacagtagacagtcggaagatgacgattcagagactgaaaaacctgaggctgatgacccaaaggataatacagaagcagaaaagcgagacccccaggaactcgtggcctccttttctgaaagagttcggaacatgtcgcctgatgaaatcaagatcccgccagaaccccctggcagatgttcaaatcacttgcaagacaagatccagaagctttatgaacgaaagataaaggagggaatggatatgaactacattatccaaaggaagaaagaatttcggaaccctagcatctacgagaagctgatccagttctgtgccattgacgagcttggcaccaactacccaaaggatatgtttgatccccatggctggtctgaggactcctactatgaggcattagccaaggcccagaaaattgagatggacaaattggaaaaggccaaaaaggagcgaacaaaaattgagtttgtgacgggcaccaaaaaaggcaccacgaccaacgccacgtccaccaccactaccactgccagcacagctgttgcagatgctcagaagagaaagagcaagtgggattcggctatcccagtgacaacgatagcccagcccaccatcctcaccaccacagccaccctgccagctgttgtcacggtcaccaccagcgccagcggctccaagaccaccgtcatctctgctgtgggcaccattgtgaagaaggccaagcagtgacctgaggggccaccctaggacttgaaaggaccgtgcagcccagtgaccactgcccagtgggaggcgccactttgtatatttcaggactgggacctactccccagatgccacctgagaggagcttctgtttggcattccagatggaaggacaggcagcacgggagccaggcgctgtggacagggtctgtccacgcaccacctggggtctgccgcctattaaaagtgccgtattcttacctcttggcatctcagatgcactggcctctcctgcattctgtttgcaggcaaatgcttcagctcacatgtcccccaagactcaatagtcttggttgggactattgcctcagggttgacaacagggtgatggaggcctgggacgctgttcagaggggtgacccaagaagtcaccgttgttatccgtgtatgcctctgggcatggacaggcgggagtccccgagccccacgtatgccccatctgccgccttgatcccaaaacccagccagttctcgggtgatggtggagctgtgctcccttgagtgcacttgagcactccccagaccagatcactttttggacacacccaggaaggcttttgaagtcaagccagtttccagaagggctggggtgagatcctgacctgtgcagagagtggggaggcgtcagcgcctggccagggctgccccagtcctttggtgcccggtgagcgcagccagcaggagctgagcagcgggggagatgaatcacctcctgccttggcgaggcggcagctcattgtttacaggcaagccctgctcctgggagggctcctgccaccccacccttcctctgtgtgttatctctgccccacagcagcccctgggcagcaccagtggccactgggctccccccggggttgaaacgggtttcccagaccaggggttcagaggagactatttacccttcatgatctttggcgattctccactggagcggaagggctgtgtgtcaaaagaaggaagccaggctgtgaagggccgtgttgctttcagtgggtgggcagaggtttagaaaggtggttctgaaatggcacctggtactcttgtgggacctggggaatataaggaactctgtgcatgaggtttcaaaaataaaaattgagtccactctccccgtacacacacactcgggcacttcaggaggtcagttctcaccccttcctcgatggggctttaaagctctggggagaagagctgctccccactcatgccccagagggactgtgaaaaggcttcctgtgacctccgatggcggcccctcattggccaagggcactgtggatgttttgtgggaggcagcatggcaccgtggaaagggcagtagacgtggagccggcacctctggtctggattccacttaaaaccagttgagtggtctcaagcccttaacctctgtaagcctgtttcttctctgaaatcacagtaataaagcgtcgtaagatggttgggaagaaccagaggtgacttatgcaaaagctttataaactgtaaagttcctgcca
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:29115 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:29115 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:29115 -> Biological process: GO:0006355 [regulation of transcription, DNA-dependent] evidence: IEA
            GeneID:29115 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:29115 -> Biological process: GO:0006917 [induction of apoptosis] evidence: IDA
            GeneID:29115 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:29115 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
            GeneID:29115 -> Cellular component: GO:0045111 [intermediate filament cytoskeleton] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.