Home |
Help |
Advanced search
2024-04-24 08:26:31, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_012479 3779 bp mRNA linear PRI 07-JUL-2013
DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, gamma polypeptide (YWHAG), mRNA.
ACCESSION NM_012479
VERSION NM_012479.3 GI:194733744
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 3779)
AUTHORS Radhakrishnan,V.M., Putnam,C.W. and Martinez,J.D.
TITLE Activation of phosphatidylinositol 3-kinase (PI3K) and
mitogen-activated protein kinase (MAPK) signaling and the
consequent induction of transformation by overexpressed 14-3-3gamma
protein require specific amino acids within 14-3-3gamma N-terminal
variable region II
JOURNAL J. Biol. Chem. 287 (52), 43300-43311 (2012)
PUBMED 23115241
REMARK GeneRIF: Using individual amino acid substitutions within the
14-3-3gamma VRII, we identified two residues required for and two
contributing to the gamma-specific phenotypes.
REFERENCE 2 (bases 1 to 3779)
AUTHORS Song,Y., Yang,Z., Ke,Z., Yao,Y., Hu,X., Sun,Y., Li,H., Yin,J. and
Zeng,C.
TITLE Expression of 14-3-3gamma in patients with breast cancer:
correlation with clinicopathological features and prognosis
JOURNAL Cancer Epidemiol 36 (6), 533-536 (2012)
PUBMED 22658894
REMARK GeneRIF: Increased expression of 14-3-3gamma in breast cancer is
associated significantly with tumor progression and poor prognosis.
REFERENCE 3 (bases 1 to 3779)
AUTHORS Lee,J.H., Jin,Y., He,G., Zeng,S.X., Wang,Y.V., Wahl,G.M. and Lu,H.
TITLE Hypoxia activates tumor suppressor p53 by inducing ATR-Chk1 kinase
cascade-mediated phosphorylation and consequent 14-3-3gamma
inactivation of MDMX protein
JOURNAL J. Biol. Chem. 287 (25), 20898-20903 (2012)
PUBMED 22556425
REMARK GeneRIF: hypoxia can activate p53 through inactivation of MDMX by
the ATR-Chk1-MDMX-14-3-3gamma pathway.
REFERENCE 4 (bases 1 to 3779)
AUTHORS Bustad,H.J., Skjaerven,L., Ying,M., Halskau,O., Baumann,A.,
Rodriguez-Larrea,D., Costas,M., Underhaug,J., Sanchez-Ruiz,J.M. and
Martinez,A.
TITLE The peripheral binding of 14-3-3gamma to membranes involves
isoform-specific histidine residues
JOURNAL PLoS ONE 7 (11), E49671 (2012)
PUBMED 23189152
REMARK GeneRIF: The peripheral binding of 14-3-3gamma to membranes
involves isoform-specific histidine residues.
REFERENCE 5 (bases 1 to 3779)
AUTHORS Brazda,V., Cechova,J., Coufal,J., Rumpel,S. and Jagelska,E.B.
TITLE Superhelical DNA as a preferential binding target of 14-3-3gamma
protein
JOURNAL J. Biomol. Struct. Dyn. 30 (4), 371-378 (2012)
PUBMED 22856523
REMARK GeneRIF: 14-3-3gamma protein binds strongly to long DNA targets and
shows very strong preference for supercoiled DNA.
REFERENCE 6 (bases 1 to 3779)
AUTHORS Vincenz,C. and Dixit,V.M.
TITLE 14-3-3 proteins associate with A20 in an isoform-specific manner
and function both as chaperone and adapter molecules
JOURNAL J. Biol. Chem. 271 (33), 20029-20034 (1996)
PUBMED 8702721
REFERENCE 7 (bases 1 to 3779)
AUTHORS Golsteyn,R.M., Mundt,K.E., Fry,A.M. and Nigg,E.A.
TITLE Cell cycle regulation of the activity and subcellular localization
of Plk1, a human protein kinase implicated in mitotic spindle
function
JOURNAL J. Cell Biol. 129 (6), 1617-1628 (1995)
PUBMED 7790358
REFERENCE 8 (bases 1 to 3779)
AUTHORS Morrison,D.
TITLE 14-3-3: modulators of signaling proteins?
JOURNAL Science 266 (5182), 56-57 (1994)
PUBMED 7939645
REMARK Review article
REFERENCE 9 (bases 1 to 3779)
AUTHORS Robertson,N.G., Khetarpal,U., Gutierrez-Espeleta,G.A., Bieber,F.R.
and Morton,C.C.
TITLE Isolation of novel and known genes from a human fetal cochlear cDNA
library using subtractive hybridization and differential screening
JOURNAL Genomics 23 (1), 42-50 (1994)
PUBMED 7829101
REFERENCE 10 (bases 1 to 3779)
AUTHORS Roth,D., Morgan,A., Martin,H., Jones,D., Martens,G.J., Aitken,A.
and Burgoyne,R.D.
TITLE Characterization of 14-3-3 proteins in adrenal chromaffin cells and
demonstration of isoform-specific phospholipid binding
JOURNAL Biochem. J. 301 (PT 1), 305-310 (1994)
PUBMED 8037685
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DC343104.1, BC020963.2,
AB024334.1, AC006388.3 and BI495132.1.
On Jul 31, 2008 this sequence version replaced gi:21464100.
Summary: This gene product belongs to the 14-3-3 family of proteins
which mediate signal transduction by binding to
phosphoserine-containing proteins. This highly conserved protein
family is found in both plants and mammals, and this protein is
100% identical to the rat ortholog. It is induced by growth factors
in human vascular smooth muscle cells, and is also highly expressed
in skeletal and heart muscles, suggesting an important role for
this protein in muscle tissue. It has been shown to interact with
RAF1 and protein kinase C, proteins involved in various signal
transduction pathways. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BI670297.1, AK024230.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-26 DC343104.1 29-54
27-666 BC020963.2 1-640
667-1711 AB024334.1 619-1663
1712-3257 AC006388.3 22951-24496
3258-3779 BI495132.1 8-529
FEATURES Location/Qualifiers
source 1..3779
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="7"
/map="7q11.23"
gene 1..3779
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, gamma polypeptide"
/db_xref="GeneID:7532"
/db_xref="HGNC:12852"
/db_xref="HPRD:05639"
/db_xref="MIM:605356"
exon 1..304
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/inference="alignment:Splign:1.39.8"
CDS 218..961
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/note="14-3-3 gamma; KCIP-1; protein kinase C inhibitor
protein 1"
/codon_start=1
/product="14-3-3 protein gamma"
/protein_id="NP_036611.2"
/db_xref="GI:21464101"
/db_xref="CCDS:CCDS5584.1"
/db_xref="GeneID:7532"
/db_xref="HGNC:12852"
/db_xref="HPRD:05639"
/db_xref="MIM:605356"
/translation="
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
"
misc_feature 218..220
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylmethionine, in 14-3-3 protein gamma,
alternate, partial; propagated from UniProtKB/Swiss-Prot
(P61981.2); acetylation site"
misc_feature 221..958
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/note="14-3-3 gamma, an isoform of 14-3-3 protein; Region:
14-3-3_gamma; cd10024"
/db_xref="CDD:206760"
misc_feature 221..223
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylvaline, in 14-3-3 protein gamma,
N-terminally processed, partial; N-acetylvaline, partial;
propagated from UniProtKB/Swiss-Prot (P61981.2);
acetylation site"
misc_feature order(233..235,242..247,254..259,263..268,272..274,
281..283,392..394,401..406,413..415,446..451,458..463,
470..472,479..484,491..493)
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:206760"
misc_feature order(365..367,386..388,590..592,611..616,746..751,
758..760,881..883,890..892,902..904,911..916)
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/note="peptide binding site [polypeptide binding]; other
site"
/db_xref="CDD:206760"
misc_feature 386..388
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/experiment="experimental evidence, no additional details
recorded"
/note="Interaction with phosphoserine on interacting
protein; propagated from UniProtKB/Swiss-Prot (P61981.2);
other site"
misc_feature 611..613
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/experiment="experimental evidence, no additional details
recorded"
/note="Interaction with phosphoserine on interacting
protein; propagated from UniProtKB/Swiss-Prot (P61981.2);
other site"
misc_feature 650..652
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine; propagated from
UniProtKB/Swiss-Prot (P61981.2); phosphorylation site"
exon 305..3747
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/inference="alignment:Splign:1.39.8"
variation 667
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/replace="c"
/replace="t"
/db_xref="dbSNP:2072435"
variation 781
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/replace="c"
/replace="t"
/db_xref="dbSNP:79130202"
variation 1458
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/replace="a"
/replace="g"
/db_xref="dbSNP:11541900"
variation 1505
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/replace="c"
/replace="g"
/db_xref="dbSNP:11541901"
variation 2211
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/replace="g"
/replace="t"
/db_xref="dbSNP:1046304"
variation 2256
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/replace="c"
/replace="t"
/db_xref="dbSNP:1046305"
STS 2401..2485
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/standard_name="D7S551E"
/db_xref="UniSTS:20499"
STS 2656..2744
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/standard_name="D7S1878E"
/db_xref="UniSTS:473333"
STS 2910..3071
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/standard_name="D7S2057E"
/db_xref="UniSTS:151115"
STS 2989..3079
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/standard_name="1138"
/db_xref="UniSTS:26350"
variation 3282
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/replace="a"
/replace="t"
/db_xref="dbSNP:11541903"
STS 3496..3609
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/standard_name="A002D37"
/db_xref="UniSTS:51041"
STS 3496..3609
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/standard_name="G19981"
/db_xref="UniSTS:62820"
STS 3532..3677
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
/standard_name="RH12457"
/db_xref="UniSTS:78291"
polyA_signal 3721..3726
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
polyA_site 3747
/gene="YWHAG"
/gene_synonym="14-3-3GAMMA"
ORIGIN
agggggttgtccgtcagtggcacgcacagcagccgcagccgcctcgcgcccggtcccgcggtcgcagctccagccgcctcctccgcgcagccgccgcctcagctgctcgctctgtgggtcggtcctctccggcacttgggctccagtcgcgccctccaagcccttcaggccgccccagtgtcctcctccttctccggccagacccagccccgcgaagatggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctacgacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtcgaatgaggaacgaaaccttctgtctgtggcctacaagaacgttgtgggggcacgccgctcttcctggagggtcatcagtagcattgagcagaagacatctgcagacggcaatgagaagaagattgagatggtccgtgcgtaccgggagaagatagagaaggagttggaggctgtgtgccaggatgtgctgagcctgctggataactacctgatcaagaattgcagcgagacccagtacgagagcaaagtgttctacctgaagatgaaaggggactactaccgctacctggctgaagtggccaccggagagaaaagggcgacggtggtggagtcctccgagaaggcctacagcgaagcccacgagatcagcaaagagcacatgcagcccacccaccccatccgattaggcctggctcttaactactccgtcttctactatgagatccagaacgccccagagcaagcgtgccacttggccaagaccgcgttcgacgacgccatcgccgagcttgacaccctcaacgaggactcctacaaggactccacgctcatcatgcagctcctccgcgacaacctcacgctctggacgagcgaccagcaggacgacgatggcggcgaaggcaacaattaaggccccaggggaactggcagcgcacgcggatgctactactgcagtctttatttttttcccatgagttgggggtcgggtgggggagggaaagggagggatgaccttcccagggagaaacccacgacctgtcctgtctttgatcgcctctttgacatttttgccaaaataccactagtggaaagtcaggctagctgtgctggtattggaatagcagcctcacactggcgtctggactgttctgtagattcatgcaagtggagctgtctgtctctaatttaacttattgctagataatagggttttcagatgaaaagaaaacttaaagaggaatggccctcattcagtaagttctgtggttccagtaaggatttttatgtacatacgctctcgtctctcgttttgggtactttctatctcatctgtctcggctctgcatgttttccagggtgtagcctacagacatggaacagtgtaaatcccagactgacagacttagaacctgaggtctcattcatccttatggtttaggccttgccagttttccgaagtctctgattagttgacagtattaacactaaattgcagtttacagtatttctacattacagccatatgtaacatcaagccatcgattgtgtacttttcctttgctagttgtttgggctttaacatccttattcagccttatccaggttggttttgctgttgatcggtctcctaggctaaatgagaatgaaagcgacttcaggtcaggtggctgtgggattttttttttttggtccttctttcctcttaacgtaaatccaccaccaaaattattaatcctcttgagagaaacgtgaaacgccacaaaaatagagaaaattcaggtctgtatgtcatggatcgtgttggtattttcagagaacatcccgcttctgaagctgctgcagctccctcctcagggatcacactgccgtcacccactctgcactggggcgtttcctactgcgcctcgtgctggcggacgcagctgggtgcagaagctgtggggtcggagaggcgtttggagaaggtctgtggtgcagtgtgtgaaaattcaggtgctagaagcctactggtagaaaaacccaaaaggaagagctatatccttaaccattctgtccaatttcgggagccttgtcagtgtgtcagtttttcctccccgaagacactccttccccaagtaattgtaggaagataaaaaaactgttaccagataacaaacactgaactcctatttgaccagaactttttcctctcgagatagttttttctttttaatgaaaaaagcataggaattggagattggcttgtctcacgcagccagtgcacatttggaattgacggaaacaacgttgctatttccacccatttgttttcggcagccttaaggccctcattctcatttcgggtgaatctgtctatctgtgaacgtggcccgcatgtgcattcttttttttatatatataaagtcagtgacgaggaactcccgagacgtgtaatgacaccacacttgttttctttgtttctttgttttatttaggcaagaagaggtgtgagtaattgaggaaaaactgacagatgcttttgctaataccaaaattgagcttacaattaggaactgagtatgtgtaacaggatacaggtgacagtgaagatagaagaaccacgatgaccacagactcaatgtgctctgtaacatcgcacagtttacccagcatgactttccttaggaggccccctcctcacgctagagtaaaagtcccagttaagtgaagcctaccagaagaactagtagaagaagctttgccgcttttgtgcctctcacaggcgcctaaagtcattgccatgggaggaagacgatttggggggggaggggggggggggcagggtaggtggggctttccctaatttatcttcatgtccagtgagcagtgttgcgtttttccttgtagcatttggaaatgatttactggaattacaaaacctatttttcctttaaatttcagctttggctctggctgctttttagaataatgcaagataaaaatcacacctgagggctgaaaacggagagggaatgggagacttgatatttaagcagcttgaatggtttttcttttctttatttttaaagaaatgcacttgcctatgatactgtctctccagtgaaatgattactcctccattactctattgatacaatattgtgcatgctagtgttgtatttctatacagtagcttgaaattgattaacttatactgtaggtgttatgtattcctatgacaaaaaaaattaagtcttcaaattttttaaaggttttttttttttaatttaatttttccttttgggggtaaagtttgctctaccaaatagtgattgtaacaaattgatctgttttggatgttgctatagtgacatgcagttatatattttgtttttaaaagggggggagcaaaagaaacaccagtgttagcttaatcttaatgtctggtgtttgtcatggtgaaattataactattacagtgttggagaacaacaaatatgttctctgaatgagcctttgtgctttttgtcatgttatgcagtgaactatttttaaggtctaatcagtgattatttttccagctccgtgtttctctaaggaattatttcacacacggaccatctttagcagtttcctcagtgatggaatatcatgaatgtgagtcattatgtagctgtcgtacattgagcaaataaacttacagatctgacgccagtgaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7532 -> Molecular function: GO:0005080 [protein kinase C binding] evidence: IPI
GeneID:7532 -> Molecular function: GO:0005159 [insulin-like growth factor receptor binding] evidence: IPI
GeneID:7532 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:7532 -> Molecular function: GO:0008426 [protein kinase C inhibitor activity] evidence: NAS
GeneID:7532 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IEA
GeneID:7532 -> Molecular function: GO:0030971 [receptor tyrosine kinase binding] evidence: IEA
GeneID:7532 -> Biological process: GO:0000086 [G2/M transition of mitotic cell cycle] evidence: TAS
GeneID:7532 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:7532 -> Biological process: GO:0006469 [negative regulation of protein kinase activity] evidence: NAS
GeneID:7532 -> Biological process: GO:0006605 [protein targeting] evidence: IEA
GeneID:7532 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:7532 -> Biological process: GO:0009966 [regulation of signal transduction] evidence: NAS
GeneID:7532 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS
GeneID:7532 -> Biological process: GO:0045664 [regulation of neuron differentiation] evidence: IMP
GeneID:7532 -> Biological process: GO:0048167 [regulation of synaptic plasticity] evidence: IMP
GeneID:7532 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:7532 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS
GeneID:7532 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:7532 -> Cellular component: GO:0030659 [cytoplasmic vesicle membrane] evidence: TAS
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.