GGRNA Home | Help | Advanced search

2024-04-27 12:16:33, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_012131                731 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens claudin 17 (CLDN17), mRNA.
ACCESSION   NM_012131
VERSION     NM_012131.2  GI:297515473
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 731)
  AUTHORS   Barber,M.J., Mangravite,L.M., Hyde,C.L., Chasman,D.I., Smith,J.D.,
            McCarty,C.A., Li,X., Wilke,R.A., Rieder,M.J., Williams,P.T.,
            Ridker,P.M., Chatterjee,A., Rotter,J.I., Nickerson,D.A.,
            Stephens,M. and Krauss,R.M.
  TITLE     Genome-wide association of lipid-lowering response to statins in
            combined study populations
  JOURNAL   PLoS ONE 5 (3), E9763 (2010)
   PUBMED   20339536
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 731)
  AUTHORS   Lal-Nag,M. and Morin,P.J.
  TITLE     The claudins
  JOURNAL   Genome Biol. 10 (8), 235 (2009)
   PUBMED   19706201
  REMARK    Review article
REFERENCE   3  (bases 1 to 731)
  AUTHORS   Krause,G., Winkler,L., Mueller,S.L., Haseloff,R.F., Piontek,J. and
            Blasig,I.E.
  TITLE     Structure and function of claudins
  JOURNAL   Biochim. Biophys. Acta 1778 (3), 631-645 (2008)
   PUBMED   18036336
  REMARK    Review article
REFERENCE   4  (bases 1 to 731)
  AUTHORS   Hu,Y.H., Warnatz,H.J., Vanhecke,D., Wagner,F., Fiebitz,A.,
            Thamm,S., Kahlem,P., Lehrach,H., Yaspo,M.L. and Janitz,M.
  TITLE     Cell array-based intracellular localization screening reveals novel
            functional features of human chromosome 21 proteins
  JOURNAL   BMC Genomics 7, 155 (2006)
   PUBMED   16780588
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 731)
  AUTHORS   Clark,H.F., Gurney,A.L., Abaya,E., Baker,K., Baldwin,D., Brush,J.,
            Chen,J., Chow,B., Chui,C., Crowley,C., Currell,B., Deuel,B.,
            Dowd,P., Eaton,D., Foster,J., Grimaldi,C., Gu,Q., Hass,P.E.,
            Heldens,S., Huang,A., Kim,H.S., Klimowski,L., Jin,Y., Johnson,S.,
            Lee,J., Lewis,L., Liao,D., Mark,M., Robbie,E., Sanchez,C.,
            Schoenfeld,J., Seshagiri,S., Simmons,L., Singh,J., Smith,V.,
            Stinson,J., Vagts,A., Vandlen,R., Watanabe,C., Wieand,D., Woods,K.,
            Xie,M.H., Yansura,D., Yi,S., Yu,G., Yuan,J., Zhang,M., Zhang,Z.,
            Goddard,A., Wood,W.I., Godowski,P. and Gray,A.
  TITLE     The secreted protein discovery initiative (SPDI), a large-scale
            effort to identify novel human secreted and transmembrane proteins:
            a bioinformatics assessment
  JOURNAL   Genome Res. 13 (10), 2265-2270 (2003)
   PUBMED   12975309
  REMARK    Erratum:[Genome Res. 2003 Dec;13(12):2759]
REFERENCE   6  (bases 1 to 731)
  AUTHORS   Tsukita,S. and Furuse,M.
  TITLE     Claudin-based barrier in simple and stratified cellular sheets
  JOURNAL   Curr. Opin. Cell Biol. 14 (5), 531-536 (2002)
   PUBMED   12231346
  REMARK    Review article
REFERENCE   7  (bases 1 to 731)
  AUTHORS   Brandner,J.M., Kief,S., Grund,C., Rendl,M., Houdek,P., Kuhn,C.,
            Tschachler,E., Franke,W.W. and Moll,I.
  TITLE     Organization and formation of the tight junction system in human
            epidermis and cultured keratinocytes
  JOURNAL   Eur. J. Cell Biol. 81 (5), 253-263 (2002)
   PUBMED   12067061
REFERENCE   8  (bases 1 to 731)
  AUTHORS   Tsukita,S., Furuse,M. and Itoh,M.
  TITLE     Multifunctional strands in tight junctions
  JOURNAL   Nat. Rev. Mol. Cell Biol. 2 (4), 285-293 (2001)
   PUBMED   11283726
  REMARK    Review article
REFERENCE   9  (bases 1 to 731)
  AUTHORS   Heiskala,M., Peterson,P.A. and Yang,Y.
  TITLE     The roles of claudin superfamily proteins in paracellular transport
  JOURNAL   Traffic 2 (2), 93-98 (2001)
   PUBMED   11247307
  REMARK    Review article
REFERENCE   10 (bases 1 to 731)
  AUTHORS   Kniesel,U. and Wolburg,H.
  TITLE     Tight junctions of the blood-brain barrier
  JOURNAL   Cell. Mol. Neurobiol. 20 (1), 57-76 (2000)
   PUBMED   10690502
  REMARK    Review article
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from BC101503.1.
            On Jun 4, 2010 this sequence version replaced gi:6912315.
            
            Summary: This gene encodes a member of the claudin family. Claudins
            are integral membrane proteins and components of tight junction
            strands. Tight junction strands serve as a physical barrier to
            prevent solutes and water from passing freely through the
            paracellular space between epithelial or endothelial cell sheets,
            and also play critical roles in maintaining cell polarity and
            signal transductions. This gene is intronless and is clustered with
            CLDN8 on chromosome 21q22.11. [provided by RefSeq, Jun 2010].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript is intronless :: BC101503.1 [ECO:0000345]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-731               BC101503.1         1-731
FEATURES             Location/Qualifiers
     source          1..731
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="21"
                     /map="21q22.11"
     gene            1..731
                     /gene="CLDN17"
                     /note="claudin 17"
                     /db_xref="GeneID:26285"
                     /db_xref="HGNC:2038"
                     /db_xref="HPRD:10833"
     exon            1..731
                     /gene="CLDN17"
                     /inference="alignment:Splign:1.39.8"
     STS             1..731
                     /gene="CLDN17"
                     /db_xref="UniSTS:486937"
     CDS             37..711
                     /gene="CLDN17"
                     /note="human CLDN17 gene for claudin-17"
                     /codon_start=1
                     /product="claudin-17"
                     /protein_id="NP_036263.1"
                     /db_xref="GI:6912316"
                     /db_xref="CCDS:CCDS13586.1"
                     /db_xref="GeneID:26285"
                     /db_xref="HGNC:2038"
                     /db_xref="HPRD:10833"
                     /translation="
MAFYPLQIAGLVLGFLGMVGTLATTLLPQWRVSAFVGSNIIVFERLWEGLWMNCIRQARVRLQCKFYSSLLALPPALETARALMCVAVALSLIALLIGICGMKQVQCTGSNERAKAYLLGTSGVLFILTGIFVLIPVSWTANIIIRDFYNPAIHIGQKRELGAALFLGWASAAVLFIGGGLLCGFCCCNRKKQGYRYPVPGYRVPHTDKRRNTTMLSKTSTSYV
"
     misc_feature    52..555
                     /gene="CLDN17"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl15797"
                     /db_xref="CDD:210197"
     misc_feature    58..120
                     /gene="CLDN17"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P56750.1);
                     transmembrane region"
     misc_feature    280..342
                     /gene="CLDN17"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P56750.1);
                     transmembrane region"
     misc_feature    409..471
                     /gene="CLDN17"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P56750.1);
                     transmembrane region"
     misc_feature    529..591
                     /gene="CLDN17"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P56750.1);
                     transmembrane region"
     variation       280
                     /gene="CLDN17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:35531957"
ORIGIN      
ccactccgaattgaaccagtcttcaaagtaaaggcaatggcattttatcccttgcaaattgctgggctggttcttgggttccttggcatggtggggactcttgccacaacccttctgcctcagtggagagtatcagcttttgttggcagcaacattattgtctttgagaggctctgggaagggctctggatgaattgcatccgacaagccagggtccggttgcaatgcaagttctatagctccttgttggctctcccgcctgccctggaaacagcccgggccctcatgtgtgtggctgttgctctctccttgatcgccctgcttattggcatctgtggcatgaagcaggtccagtgcacaggctctaacgagagggccaaagcataccttctgggaacttcaggagtcctcttcatcctgacgggcatcttcgttctgattccggtgagctggacagccaatataatcatcagagatttctacaacccagccatccacataggtcagaaacgagagctgggagcagcacttttccttggctgggcaagcgctgctgtcctcttcattggagggggtctgctttgtggattttgctgctgcaacagaaagaagcaagggtacagatatccagtgcctggctaccgtgtgccacacacagataagcgaagaaatacgacaatgcttagtaagacctccaccagttatgtctaatgcctccttttggctccaag
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:26285 -> Molecular function: GO:0005198 [structural molecule activity] evidence: IEA
            GeneID:26285 -> Molecular function: GO:0042802 [identical protein binding] evidence: ISS
            GeneID:26285 -> Biological process: GO:0016338 [calcium-independent cell-cell adhesion] evidence: ISS
            GeneID:26285 -> Biological process: GO:0034329 [cell junction assembly] evidence: TAS
            GeneID:26285 -> Biological process: GO:0045216 [cell-cell junction organization] evidence: TAS
            GeneID:26285 -> Biological process: GO:0070830 [tight junction assembly] evidence: TAS
            GeneID:26285 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IDA
            GeneID:26285 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
            GeneID:26285 -> Cellular component: GO:0005923 [tight junction] evidence: ISS
            GeneID:26285 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.