GGRNA | NM_007179.2

LOCUS       NM_007179                711 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens insulin-like 6 (INSL6), mRNA.
ACCESSION   NM_007179 NM_016421
VERSION     NM_007179.2  GI:38569395
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 711)
  AUTHORS   Asano,K., Matsushita,T., Umeno,J., Hosono,N., Takahashi,A.,
            Kawaguchi,T., Matsumoto,T., Matsui,T., Kakuta,Y., Kinouchi,Y.,
            Shimosegawa,T., Hosokawa,M., Arimura,Y., Shinomura,Y., Kiyohara,Y.,
            Tsunoda,T., Kamatani,N., Iida,M., Nakamura,Y. and Kubo,M.
  TITLE     A genome-wide association study identifies three new susceptibility
            loci for ulcerative colitis in the Japanese population
  JOURNAL   Nat. Genet. 41 (12), 1325-1329 (2009)
   PUBMED   19915573
REFERENCE   2  (bases 1 to 711)
  AUTHORS   Humphray,S.J., Oliver,K., Hunt,A.R., Plumb,R.W., Loveland,J.E.,
            Howe,K.L., Andrews,T.D., Searle,S., Hunt,S.E., Scott,C.E.,
            Jones,M.C., Ainscough,R., Almeida,J.P., Ambrose,K.D., Ashwell,R.I.,
            Babbage,A.K., Babbage,S., Bagguley,C.L., Bailey,J., Banerjee,R.,
            Barker,D.J., Barlow,K.F., Bates,K., Beasley,H., Beasley,O.,
            Bird,C.P., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D.,
            Burrill,W., Burton,J., Carder,C., Carter,N.P., Chapman,J.C.,
            Chen,Y., Clarke,G., Clark,S.Y., Clee,C.M., Clegg,S., Collier,R.E.,
            Corby,N., Crosier,M., Cummings,A.T., Davies,J., Dhami,P., Dunn,M.,
            Dutta,I., Dyer,L.W., Earthrowl,M.E., Faulkner,L., Fleming,C.J.,
            Frankish,A., Frankland,J.A., French,L., Fricker,D.G., Garner,P.,
            Garnett,J., Ghori,J., Gilbert,J.G., Glison,C., Grafham,D.V.,
            Gribble,S., Griffiths,C., Griffiths-Jones,S., Grocock,R., Guy,J.,
            Hall,R.E., Hammond,S., Harley,J.L., Harrison,E.S., Hart,E.A.,
            Heath,P.D., Henderson,C.D., Hopkins,B.L., Howard,P.J., Howden,P.J.,
            Huckle,E., Johnson,C., Johnson,D., Joy,A.A., Kay,M., Keenan,S.,
            Kershaw,J.K., Kimberley,A.M., King,A., Knights,A., Laird,G.K.,
            Langford,C., Lawlor,S., Leongamornlert,D.A., Leversha,M., Lloyd,C.,
            Lloyd,D.M., Lovell,J., Martin,S., Mashreghi-Mohammadi,M.,
            Matthews,L., McLaren,S., McLay,K.E., McMurray,A., Milne,S.,
            Nickerson,T., Nisbett,J., Nordsiek,G., Pearce,A.V., Peck,A.I.,
            Porter,K.M., Pandian,R., Pelan,S., Phillimore,B., Povey,S.,
            Ramsey,Y., Rand,V., Scharfe,M., Sehra,H.K., Shownkeen,R.,
            Sims,S.K., Skuce,C.D., Smith,M., Steward,C.A., Swarbreck,D.,
            Sycamore,N., Tester,J., Thorpe,A., Tracey,A., Tromans,A.,
            Thomas,D.W., Wall,M., Wallis,J.M., West,A.P., Whitehead,S.L.,
            Willey,D.L., Williams,S.A., Wilming,L., Wray,P.W., Young,L.,
            Ashurst,J.L., Coulson,A., Blocker,H., Durbin,R., Sulston,J.E.,
            Hubbard,T., Jackson,M.J., Bentley,D.R., Beck,S., Rogers,J. and
            Dunham,I.
  TITLE     DNA sequence and analysis of human chromosome 9
  JOURNAL   Nature 429 (6990), 369-374 (2004)
   PUBMED   15164053
REFERENCE   3  (bases 1 to 711)
  AUTHORS   Lok,S., Johnston,D.S., Conklin,D., Lofton-Day,C.E., Adams,R.L.,
            Jelmberg,A.C., Whitmore,T.E., Schrader,S., Griswold,M.D. and
            Jaspers,S.R.
  TITLE     Identification of INSL6, a new member of the insulin family that is
            expressed in the testis of the human and rat
  JOURNAL   Biol. Reprod. 62 (6), 1593-1599 (2000)
   PUBMED   10819760
REFERENCE   4  (bases 1 to 711)
  AUTHORS   Hsu,S.Y.
  TITLE     Cloning of two novel mammalian paralogs of relaxin/insulin family
            proteins and their expression in testis and kidney
  JOURNAL   Mol. Endocrinol. 13 (12), 2163-2174 (1999)
   PUBMED   10598589
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF156094.1 and AW117587.1.
            On Dec 1, 2003 this sequence version replaced gi:6005789.
            
            Summary: The protein encoded by this gene contains a classical
            signature of the insulin superfamily and is significantly similar
            to relaxin and relaxin-like factor. This gene is preferentially
            expressed in testis. Its expression in testis is restricted to
            interstitial cells surrounding seminiferous tubules, which suggests
            a role in sperm development and fertilization. [provided by RefSeq,
            Jul 2008].
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF156094.1, BC126473.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025085, ERS025091 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-451               AF156094.1         1-451
            452-711             AW117587.1         1-260               c
FEATURES             Location/Qualifiers
     source          1..711
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="9"
                     /map="9p24"
     gene            1..711
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /note="insulin-like 6"
                     /db_xref="GeneID:11172"
                     /db_xref="HGNC:6089"
                     /db_xref="HPRD:08401"
                     /db_xref="MIM:606414"
     STS             1..708
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /db_xref="UniSTS:489824"
     exon            1..305
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /inference="alignment:Splign:1.39.8"
     CDS             17..658
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /note="insulin-like peptide 5; insulin-like peptide INSL6;
                     relaxin/insulin-like factor 1; insulin-like peptide 6"
                     /codon_start=1
                     /product="insulin-like peptide INSL6 precursor"
                     /protein_id="NP_009110.2"
                     /db_xref="GI:38569396"
                     /db_xref="CCDS:CCDS6458.1"
                     /db_xref="GeneID:11172"
                     /db_xref="HGNC:6089"
                     /db_xref="HPRD:08401"
                     /db_xref="MIM:606414"
                     /translation="

MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDFKRLKEKRSSLVTKIY

"
     sig_peptide     17..76
                     /gene="INSL6"
                     /gene_synonym="RIF1"
     mat_peptide     77..655
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /product="insulin-like peptide INSL6"
     misc_feature    101..>178
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /note="Insulin/insulin-like growth factor/relaxin family;
                     insulin family of proteins. Members include a number of
                     active peptides which are evolutionary related including
                     insulin, relaxin, prorelaxin, insulin-like growth factors
                     I and II, mammalian Leydig...; Region: IlGF_like; cl02453"
                     /db_xref="CDD:194317"
     misc_feature    <497..592
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /note="IlGF_like family, relaxin_like subgroup, specific
                     to vertebrates. Members include a number of active
                     peptides including (pro)relaxin, mammalian Leydig
                     cell-specific insulin-like peptide (gene INSL3), early
                     placenta insulin-like peptide (ELIP; gene INSL4); Region:
                     IlGF_relaxin_like; cd04365"
                     /db_xref="CDD:58534"
     variation       50
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:35211475"
     exon            306..708
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /inference="alignment:Splign:1.39.8"
     variation       388
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35192311"
     variation       420
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34832229"
     variation       468
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34567633"
     polyA_signal    683..688
                     /gene="INSL6"
                     /gene_synonym="RIF1"
     polyA_site      703
                     /gene="INSL6"
                     /gene_synonym="RIF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     polyA_site      708
                     /gene="INSL6"
                     /gene_synonym="RIF1"
ORIGIN

gcctggggtcacagggatgccgcggctcctccgcttgtccctgctgtggcttggactcctgctggttcggttttctcgtgaactgagcgacatcagcagtgccaggaagctgtgcggcaggtacttggtgaaagaaatagaaaaactctgcggccatgccaactggagccagttccgtttcgaggaggaaacccctttctcacggttgattgcacaggcctcggagaaggtcgaagcctacagcccataccagttcgaaagcccgcaaaccgcttccccggcccggggaagaggcacaaacccagtgtctacttcttgggaagaagcagtaaacagttgggaaatgcagtcactacctgagtataaggataaaaagggatattcaccccttggtaagacaagagaattttcttcatcacataatatcaatgtatatattcatgagaatgcaaaatttcagaagaaacgtagaaacaaaattaaaaccttaagcaatttgttttgggggcatcatccccaaagaaaacgcagaggatattcagaaaagtgttgtcttacaggatgtacaaaagaagaacttagcattgcatgtcttccatatattgattttaaaaggctaaaggaaaaaagatcatcacttgtaactaagatatactaaccatcttagaattttttctaacctaataaaagcttaatacatttatttaaaaa

//

Annotations: