GGRNA Home | Help | Advanced search

2024-04-26 05:56:53, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_007074               1825 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens coronin, actin binding protein, 1A (CORO1A),
            transcript variant 2, mRNA.
ACCESSION   NM_007074
VERSION     NM_007074.3  GI:306482593
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1825)
  AUTHORS   Oku,T., Nakano,M., Kaneko,Y., Ando,Y., Kenmotsu,H., Itoh,S.,
            Tsuiji,M., Seyama,Y., Toyoshima,S. and Tsuji,T.
  TITLE     Constitutive turnover of phosphorylation at Thr-412 of human
            p57/coronin-1 regulates the interaction with actin
  JOURNAL   J. Biol. Chem. 287 (51), 42910-42920 (2012)
   PUBMED   23100250
  REMARK    GeneRIF: Constitutive turnover of phosphorylation at Thr-412 of
            p57/coronin-1 regulates its interaction with actin.
REFERENCE   2  (bases 1 to 1825)
  AUTHORS   Castro-Castro,A., Ojeda,V., Barreira,M., Sauzeau,V.,
            Navarro-Lerida,I., Muriel,O., Couceiro,J.R., Pimentel-Muinos,F.X.,
            Del Pozo,M.A. and Bustelo,X.R.
  TITLE     Coronin 1A promotes a cytoskeletal-based feedback loop that
            facilitates Rac1 translocation and activation
  JOURNAL   EMBO J. 30 (19), 3913-3927 (2011)
   PUBMED   21873980
  REMARK    GeneRIF: Coronin 1A promotes a cytoskeletal-based feedback loop
            that facilitates Rac1 translocation and activation
            Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1825)
  AUTHORS   Mueller,P., Liu,X. and Pieters,J.
  TITLE     Migration and homeostasis of naive T cells depends on coronin
            1-mediated prosurvival signals and not on coronin 1-dependent
            filamentous actin modulation
  JOURNAL   J. Immunol. 186 (7), 4039-4050 (2011)
   PUBMED   21339362
  REMARK    GeneRIF: Instead of regulating the F-actin cytoskeleton, coronin 1
            functions in balancing pro- and antiapoptotic signals by regulating
            divalent calcium ion fluxes and calcineurin activation downstream
            of the T cell receptor.
REFERENCE   4  (bases 1 to 1825)
  AUTHORS   Moriceau,S., Kantari,C., Mocek,J., Davezac,N., Gabillet,J.,
            Guerrera,I.C., Brouillard,F., Tondelier,D., Sermet-Gaudelus,I.,
            Danel,C., Lenoir,G., Daniel,S., Edelman,A. and Witko-Sarsat,V.
  TITLE     Coronin-1 is associated with neutrophil survival and is cleaved
            during apoptosis: potential implication in neutrophils from cystic
            fibrosis patients
  JOURNAL   J. Immunol. 182 (11), 7254-7263 (2009)
   PUBMED   19454722
  REMARK    GeneRIF: Circulating neutrophils from CF patients had more
            coronin-1 expression, associated with a lower apoptosis rate
REFERENCE   5  (bases 1 to 1825)
  AUTHORS   Shiow,L.R., Roadcap,D.W., Paris,K., Watson,S.R., Grigorova,I.L.,
            Lebet,T., An,J., Xu,Y., Jenne,C.N., Foger,N., Sorensen,R.U.,
            Goodnow,C.C., Bear,J.E., Puck,J.M. and Cyster,J.G.
  TITLE     The actin regulator coronin 1A is mutant in a thymic
            egress-deficient mouse strain and in a patient with severe combined
            immunodeficiency
  JOURNAL   Nat. Immunol. 9 (11), 1307-1315 (2008)
   PUBMED   18836449
  REMARK    GeneRIF: Findings establish a function for coronin 1A in T cell
            egress, identify a surface of coronin involved in Arp2/3
            regulation.
REFERENCE   6  (bases 1 to 1825)
  AUTHORS   Vanguri,V.K., Wang,S., Godyna,S., Ranganathan,S. and Liau,G.
  TITLE     Thrombospondin-1 binds to polyhistidine with high affinity and
            specificity
  JOURNAL   Biochem. J. 347 (PT 2), 469-473 (2000)
   PUBMED   10749676
REFERENCE   7  (bases 1 to 1825)
  AUTHORS   Ferrari,G., Langen,H., Naito,M. and Pieters,J.
  TITLE     A coat protein on phagosomes involved in the intracellular survival
            of mycobacteria
  JOURNAL   Cell 97 (4), 435-447 (1999)
   PUBMED   10338208
REFERENCE   8  (bases 1 to 1825)
  AUTHORS   Okumura,M., Kung,C., Wong,S., Rodgers,M. and Thomas,M.L.
  TITLE     Definition of family of coronin-related proteins conserved between
            humans and mice: close genetic linkage between coronin-2 and
            CD45-associated protein
  JOURNAL   DNA Cell Biol. 17 (9), 779-787 (1998)
   PUBMED   9778037
REFERENCE   9  (bases 1 to 1825)
  AUTHORS   Grogan,A., Reeves,E., Keep,N., Wientjes,F., Totty,N.F.,
            Burlingame,A.L., Hsuan,J.J. and Segal,A.W.
  TITLE     Cytosolic phox proteins interact with and regulate the assembly of
            coronin in neutrophils
  JOURNAL   J. Cell. Sci. 110 (PT 24), 3071-3081 (1997)
   PUBMED   9365277
REFERENCE   10 (bases 1 to 1825)
  AUTHORS   Suzuki,K., Nishihata,J., Arai,Y., Honma,N., Yamamoto,K., Irimura,T.
            and Toyoshima,S.
  TITLE     Molecular cloning of a novel actin-binding protein, p57, with a WD
            repeat and a leucine zipper motif
  JOURNAL   FEBS Lett. 364 (3), 283-288 (1995)
   PUBMED   7758584
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC408372.1, DA256300.1,
            BC110374.1 and U34690.1.
            On Sep 9, 2010 this sequence version replaced gi:68161542.
            
            Summary: This gene encodes a member of the WD repeat protein
            family. WD repeats are minimally conserved regions of approximately
            40 amino acids typically bracketed by gly-his and trp-asp (GH-WD),
            which may facilitate formation of heterotrimeric or multiprotein
            complexes. Members of this family are involved in a variety of
            cellular processes, including cell cycle progression, signal
            transduction, apoptosis, and gene regulation. Alternative splicing
            results in multiple transcript variants. A related pseudogene has
            been defined on chromosome 16. [provided by RefSeq, Sep 2010].
            
            Transcript Variant: This variant (2) differs in the 5' UTR compared
            to variant 1. Both variants 1 and 2 encode the same protein.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC110374.1, U34690.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-109               DC408372.1         1-109
            110-183             DA256300.1         98-171
            184-652             BC110374.1         1-469
            653-653             U34690.1           428-428
            654-1825            BC110374.1         471-1642
FEATURES             Location/Qualifiers
     source          1..1825
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="16"
                     /map="16p11.2"
     gene            1..1825
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="coronin, actin binding protein, 1A"
                     /db_xref="GeneID:11151"
                     /db_xref="HGNC:2252"
                     /db_xref="HPRD:05414"
                     /db_xref="MIM:605000"
     exon            1..316
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       110
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:930392"
     misc_feature    204..206
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="upstream in-frame stop codon"
     variation       224
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:186185074"
     STS             249..1780
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /db_xref="UniSTS:486443"
     variation       284
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11555340"
     STS             297..1742
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /db_xref="UniSTS:494834"
     exon            317..515
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     CDS             318..1703
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="coronin-1; clipin-A; coronin-like protein A;
                     coronin-like protein p57; tryptophan aspartate-containing
                     coat protein"
                     /codon_start=1
                     /product="coronin-1A"
                     /protein_id="NP_009005.1"
                     /db_xref="GI:5902134"
                     /db_xref="CCDS:CCDS10673.1"
                     /db_xref="GeneID:11151"
                     /db_xref="HGNC:2252"
                     /db_xref="HPRD:05414"
                     /db_xref="MIM:605000"
                     /translation="
MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRVDKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWHTTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTVVAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
"
     misc_feature    321..323
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N-acetylserine; propagated from
                     UniProtKB/Swiss-Prot (P31146.4); acetylation site"
     misc_feature    321..323
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphoserine, by PKC; propagated from
                     UniProtKB/Swiss-Prot (P31146.4); phosphorylation site"
     misc_feature    327..521
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="Domain of unknown function (DUF1899); Region:
                     DUF1899; pfam08953"
                     /db_xref="CDD:149883"
     misc_feature    342..1700
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="coronin; Provisional; Region: PTZ00421"
                     /db_xref="CDD:173611"
     misc_feature    354..506
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 1"
     misc_feature    534..647
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 2"
     misc_feature    543..1223
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cl02567"
                     /db_xref="CDD:207648"
     misc_feature    order(552..557,612..614,624..626,642..647,702..707,
                     759..761,774..776,792..797,840..842,891..893,906..908,
                     924..929,975..977,1023..1025,1047..1049,1065..1070,
                     1104..1106,1113..1115,1167..1169,1182..1184,1200..1205)
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="structural tetrad; other site"
                     /db_xref="CDD:29257"
     misc_feature    684..797
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 3"
     misc_feature    807..929
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 4"
     misc_feature    936..1070
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 5"
     misc_feature    1089..1493
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /note="Domain of unknown function (DUF1900); Region:
                     DUF1900; pfam08954"
                     /db_xref="CDD:149884"
     misc_feature    1089..1205
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 6"
     misc_feature    1221..1364
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P31146.4);
                     Region: WD 7"
     misc_feature    1551..1553
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="Phosphothreonine, by PKC; propagated from
                     UniProtKB/Swiss-Prot (P31146.4); phosphorylation site"
     misc_feature    1662..1664
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="N6-acetyllysine; propagated from
                     UniProtKB/Swiss-Prot (P31146.4); acetylation site"
     variation       371
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61736363"
     variation       399
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201747422"
     variation       436
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79062603"
     variation       485
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75142051"
     exon            516..638
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       538
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373022238"
     variation       554
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201766395"
     variation       555
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:11555342"
     variation       590
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141844867"
     variation       602
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184262856"
     variation       636
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201579444"
     exon            639..768
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       653
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1132812"
     variation       663
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138146826"
     variation       678
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370896577"
     variation       684
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201721540"
     variation       686
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200437355"
     variation       689
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149599538"
     variation       690
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143294920"
     variation       707
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201119953"
     exon            769..953
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       811
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371653086"
     variation       812
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374849081"
     variation       836
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199752871"
     variation       857
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369595327"
     variation       874
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148312916"
     variation       878
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141746241"
     variation       921
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145989561"
     variation       947
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139989282"
     variation       948
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371818902"
     exon            954..1073
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       963
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377504027"
     variation       966
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:141827038"
     variation       1001
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371077364"
     variation       1028
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374088140"
     variation       1055
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143729497"
     variation       1061
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200060318"
     exon            1074..1178
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1091
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187747730"
     variation       1093
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:200963965"
     variation       1109
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139024575"
     variation       1121
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149867063"
     variation       1154
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113875403"
     variation       1160
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199650298"
     exon            1179..1324
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1253
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148629867"
     variation       1262
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:144860668"
     variation       1271
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376912665"
     variation       1313
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199960741"
     STS             1316..1453
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /standard_name="RH47208"
                     /db_xref="UniSTS:88686"
     variation       1319
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377351892"
     exon            1325..1382
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1344
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112289496"
     variation       1349
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199896375"
     exon            1383..1598
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1391
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:376540649"
     variation       1394
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147924993"
     variation       1414
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:150857828"
     variation       1418
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139282852"
     variation       1463
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201734831"
     variation       1465
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:61736366"
     variation       1478
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375181897"
     variation       1489
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375532115"
     variation       1505
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151106018"
     variation       1506
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:35967690"
     variation       1521
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150186033"
     variation       1527
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11555339"
     variation       1531
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369828613"
     variation       1539
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373093101"
     variation       1550
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138821284"
     variation       1556
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199576607"
     variation       1561
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1804109"
     exon            1599..1815
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /inference="alignment:Splign:1.39.8"
     variation       1644
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1053574"
     variation       1661
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3209337"
     polyA_signal    1791..1796
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
     polyA_site      1815
                     /gene="CORO1A"
                     /gene_synonym="CLABP; CLIPINA; HCORO1; p57; TACO"
ORIGIN      
aaaaagaagtttagattcgcttcccggagccgggatggcagcctgcgctatggttggggaccaacgtggtgcacgggcaggggccggggagagaggcggccgcagcgggagcccgggagcgcagggcgggcctggaagagctccgccccaaggggcgcggccaccccggaggcgggcgcacggctgcttctcattcattgtcttgacaagagcatcttcagcgggcgagtccccggctcctccagctccttcctcctcttcctcctcctcctccacctccggcttttgggggatcactgtcctctctcggcagcagaatgagccggcaggtggtccgctccagcaagttccgccacgtgtttggacagccggccaaggccgaccagtgctatgaagatgtgcgcgtctcacagaccacctgggacagtggcttctgtgctgtcaaccctaagtttgtggccctgatctgtgaggccagcgggggaggggccttcctggtgctgcccctgggcaagactggacgtgtggacaagaatgcgcccacggtctgtggccacacagcccctgtgctagacatcgcctggtgcccgcacaatgacaacgtcattgccagtggctccgaggactgcacagtcatggtgtgggagatcccagatgggggcctgatgctgcccctgcgggagcccgtcgtcaccctggagggccacaccaagcgtgtgggcattgtggcctggcacaccacagcccagaacgtgctgctcagtgcaggttgtgacaacgtgatcatggtgtgggacgtgggcactggggcggccatgctgacactgggcccagaggtgcacccagacacgatctacagtgtggactggagccgagatggaggcctcatttgtacctcctgccgtgacaagcgcgtgcgcatcatcgagccccgcaaaggcactgtcgtagctgagaaggaccgtccccacgaggggacccggcccgtgcgtgcagtgttcgtgtcggaggggaagatcctgaccacgggcttcagccgcatgagtgagcggcaggtggcgctgtgggacacaaagcacctggaggagccgctgtccctgcaggagctggacaccagcagcggtgtcctgctgcccttctttgaccctgacaccaacatcgtctacctctgtggcaagggtgacagctcaatccggtactttgagatcacttccgaggcccctttcctgcactatctctccatgttcagttccaaggagtcccagcggggcatgggctacatgcccaaacgtggcctggaggtgaacaagtgtgagatcgccaggttctacaagctgcacgagcggaggtgtgagcccattgccatgacagtgcctcgaaagtcggacctgttccaggaggacctgtacccacccaccgcagggcccgaccctgccctcacggctgaggagtggctggggggtcgggatgctgggcccctcctcatctccctcaaggatggctacgtacccccaaagagccgggagctgagggtcaaccggggcctggacaccgggcgcaggagggcagcaccagaggccagtggcactcccagctcggatgccgtgtctcggctggaggaggagatgcggaagctccaggccacggtgcaggagctccagaagcgcttggacaggctggaggagacagtccaggccaagtagagccccgcagggcctccagcagggtcagccattcacacccatccactcacctcccattcccagccacatggcagagaaaaaaatcataataaaatggctttattttctggtaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:11151 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:11151 -> Molecular function: GO:0008022 [protein C-terminus binding] evidence: IPI
            GeneID:11151 -> Molecular function: GO:0008092 [cytoskeletal protein binding] evidence: ISS
            GeneID:11151 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IDA
            GeneID:11151 -> Molecular function: GO:0043548 [phosphatidylinositol 3-kinase binding] evidence: IDA
            GeneID:11151 -> Molecular function: GO:0051015 [actin filament binding] evidence: IDA
            GeneID:11151 -> Biological process: GO:0001845 [phagolysosome assembly] evidence: IMP
            GeneID:11151 -> Biological process: GO:0006816 [calcium ion transport] evidence: IEA
            GeneID:11151 -> Biological process: GO:0006909 [phagocytosis] evidence: IMP
            GeneID:11151 -> Biological process: GO:0006928 [cellular component movement] evidence: NAS
            GeneID:11151 -> Biological process: GO:0007015 [actin filament organization] evidence: IEA
            GeneID:11151 -> Biological process: GO:0008360 [regulation of cell shape] evidence: IBA
            GeneID:11151 -> Biological process: GO:0030036 [actin cytoskeleton organization] evidence: IMP
            GeneID:11151 -> Biological process: GO:0030335 [positive regulation of cell migration] evidence: IEA
            GeneID:11151 -> Biological process: GO:0030595 [leukocyte chemotaxis] evidence: IBA
            GeneID:11151 -> Biological process: GO:0030833 [regulation of actin filament polymerization] evidence: IEA
            GeneID:11151 -> Biological process: GO:0031589 [cell-substrate adhesion] evidence: IMP
            GeneID:11151 -> Biological process: GO:0032796 [uropod organization] evidence: IBA
            GeneID:11151 -> Biological process: GO:0042102 [positive regulation of T cell proliferation] evidence: IEA
            GeneID:11151 -> Biological process: GO:0043029 [T cell homeostasis] evidence: IEA
            GeneID:11151 -> Biological process: GO:0045087 [innate immune response] evidence: NAS
            GeneID:11151 -> Biological process: GO:0048873 [homeostasis of number of cells within a tissue] evidence: IEA
            GeneID:11151 -> Biological process: GO:0050918 [positive chemotaxis] evidence: IDA
            GeneID:11151 -> Biological process: GO:0051126 [negative regulation of actin nucleation] evidence: IDA
            GeneID:11151 -> Biological process: GO:0071353 [cellular response to interleukin-4] evidence: IEA
            GeneID:11151 -> Cellular component: GO:0001772 [immunological synapse] evidence: IEA
            GeneID:11151 -> Cellular component: GO:0001891 [phagocytic cup] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0005884 [actin filament] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0030027 [lamellipodium] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0030670 [phagocytic vesicle membrane] evidence: IEA
            GeneID:11151 -> Cellular component: GO:0030864 [cortical actin cytoskeleton] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0043234 [protein complex] evidence: IDA
            GeneID:11151 -> Cellular component: GO:0045335 [phagocytic vesicle] evidence: IDA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.