GGRNA Home | Help | Advanced search

2024-03-29 14:22:57, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_007011               9159 bp    mRNA    linear   PRI 15-JUN-2013
DEFINITION  Homo sapiens abhydrolase domain containing 2 (ABHD2), transcript
            variant 1, mRNA.
ACCESSION   NM_007011 XM_926626 XM_938496
VERSION     NM_007011.7  GI:259490349
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 9159)
  AUTHORS   Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
            Gibbs,R.A. and Butte,N.F.
  TITLE     Novel genetic loci identified for the pathophysiology of childhood
            obesity in the Hispanic population
  JOURNAL   PLoS ONE 7 (12), E51954 (2012)
   PUBMED   23251661
REFERENCE   2  (bases 1 to 9159)
  AUTHORS   Giambra,V., Cianci,R., Lolli,S., Mattioli,C., Tampella,G.,
            Cattalini,M., Kilic,S.S., Pandolfi,F., Plebani,A. and Frezza,D.
  TITLE     Allele *1 of HS1.2 enhancer associates with selective IgA
            deficiency and IgM concentration
  JOURNAL   J. Immunol. 183 (12), 8280-8285 (2009)
   PUBMED   20007591
  REMARK    GeneRIF: Patients with selective immunoglobulin (Ig)A deficiency
            have a highly significant increase of homozygousity of HS1.2 allele
            *1, with an increase of 2.6-fold; the HS1.2 polymorphism influences
            Ig seric production, but not IgG switch.
REFERENCE   3  (bases 1 to 9159)
  AUTHORS   Miyata,K., Nakayama,M., Mizuta,S., Hokimoto,S., Sugamura,K.,
            Oshima,S., Oike,Y., Sugiyama,S., Ogawa,H. and Yamamura,K.
  TITLE     Elevated mature macrophage expression of human ABHD2 gene in
            vulnerable plaque
  JOURNAL   Biochem. Biophys. Res. Commun. 365 (2), 207-213 (2008)
   PUBMED   17980156
  REMARK    GeneRIF: Our results showed that the ABHD2 was expressed in
            atherosclerotic lesions, and that the ABHD2 expression was
            significantly higher in the patients with UA than with SA.
REFERENCE   4  (bases 1 to 9159)
  AUTHORS   Girard,A., Sachidanandam,R., Hannon,G.J. and Carmell,M.A.
  TITLE     A germline-specific class of small RNAs binds mammalian Piwi
            proteins
  JOURNAL   Nature 442 (7099), 199-202 (2006)
   PUBMED   16751776
REFERENCE   5  (bases 1 to 9159)
  AUTHORS   Edgar,A.J. and Polak,J.M.
  TITLE     Cloning and tissue distribution of three murine alpha/beta
            hydrolase fold protein cDNAs
  JOURNAL   Biochem. Biophys. Res. Commun. 292 (3), 617-625 (2002)
   PUBMED   11922611
REFERENCE   6  (bases 1 to 9159)
  AUTHORS   Rapiejko,P.J., George,S.T. and Malbon,C.C.
  TITLE     Primary structure of a human protein which bears structural
            similarities to members of the rhodopsin/beta-adrenergic receptor
            family
  JOURNAL   Nucleic Acids Res. 16 (17), 8721 (1988)
   PUBMED   2843827
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC397201.1, BC019248.1,
            BC090052.1, AC124068.6 and AI918734.1.
            On Sep 25, 2009 this sequence version replaced gi:194473691.
            
            Summary: This gene encodes a protein containing an alpha/beta
            hydrolase fold, which is a catalytic domain found in a very wide
            range of enzymes. The function of this protein has not been
            determined. Alternative splicing of this gene results in two
            transcript variants encoding the same protein. [provided by RefSeq,
            Jul 2008].
            
            Transcript Variant: This variant (1) has a longer 5' UTR, as
            compared to variant 2.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data to make the sequence consistent with the
            reference genome assembly. The genomic coordinates used for the
            transcript record were based on transcript alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC019248.1 [ECO:0000332]
            RNAseq introns              :: mixed/partial sample support
                                           ERS025084, ERS025085 [ECO:0000350]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-143               DC397201.1         1-143
            144-285             DC397201.1         145-286
            286-822             BC019248.1         17-553
            823-2524            BC090052.1         159-1860
            2525-9113           AC124068.6         29331-35919
            9114-9159           AI918734.1         1-46                c
FEATURES             Location/Qualifiers
     source          1..9159
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="15"
                     /map="15q26.1"
     gene            1..9159
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /note="abhydrolase domain containing 2"
                     /db_xref="GeneID:11057"
                     /db_xref="HGNC:18717"
                     /db_xref="HPRD:09791"
                     /db_xref="MIM:612196"
     exon            1..414
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       45
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:111908488"
     variation       49
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113788281"
     variation       111
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:145772937"
     variation       179
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28366027"
     variation       189
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193284374"
     variation       265
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185529786"
     exon            415..504
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       450
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:185777908"
     exon            505..581
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     exon            582..723
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       582
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:146020115"
     exon            724..812
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       736
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373613058"
     variation       782
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56686219"
     variation       787
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143531101"
     exon            813..912
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       880
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186314767"
     misc_feature    901..903
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /note="upstream in-frame stop codon"
     exon            913..1112
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     CDS             919..2196
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /note="lung alpha/beta hydrolase 2; alpha/beta hydrolase
                     domain containing protein 2; protein PHPS1-2"
                     /codon_start=1
                     /product="abhydrolase domain-containing protein 2"
                     /protein_id="NP_008942.3"
                     /db_xref="GI:23397659"
                     /db_xref="CCDS:CCDS10348.1"
                     /db_xref="GeneID:11057"
                     /db_xref="HGNC:18717"
                     /db_xref="HPRD:09791"
                     /db_xref="MIM:612196"
                     /translation="
MNAMLETPELPAVFDGVKLAAVAAVLYVIVRCLNLKSPTAPPDLYFQDSGLSRFLLKSCPLLTKEYIPPLIWGKSGHIQTALYGKMGRVRSPHPYGHRKFITMSDGATSTFDLFEPLAEHCVGDDITMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALPNIELTSPRMFTYGCTWEFGAMVNYIKKTYPLTQLVVVGFSLGGNIVCKYLGETQANQEKVLCCVSVCQGYSALRAQETFMQWDQCRRFYNFLMADNMKKIILSHRQALFGDHVKKPQSLEDTDLSRLYTATSLMQIDDNVMRKFHGYNSLKEYYEEESCMRYLHRIYVPLMLVNAADDPLVHESLLTIPKSLSEKRENVMFVLPLHGGHLGFFEGSVLFPEPLTWMDKLVVEYANAICQWERNKLQCSDTEQVEADLE
"
     misc_feature    946..1008
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P08910.1);
                     transmembrane region"
     misc_feature    1111..2118
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /note="Predicted hydrolase of the alpha/beta-hydrolase
                     fold [General function prediction only]; Region: COG0429"
                     /db_xref="CDD:30778"
     variation       931
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200083665"
     variation       955
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377224438"
     variation       999
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:61753540"
     variation       1005..1006
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:35195117"
     variation       1076
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140016091"
     variation       1097
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141982781"
     exon            1113..1288
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1125
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144690140"
     variation       1191
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:141659881"
     variation       1197
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142873328"
     variation       1207
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377248748"
     variation       1248
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370107941"
     variation       1252
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373748122"
     exon            1289..1456
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1392
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111436651"
     variation       1393
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376591750"
     variation       1425
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200152203"
     variation       1429
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369834043"
     variation       1437
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139707395"
     variation       1446
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374535337"
     exon            1457..1640
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1464
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145289422"
     variation       1501
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147649579"
     variation       1525
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200218946"
     variation       1527
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142298746"
     variation       1584
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:199669891"
     variation       1590
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201301214"
     variation       1600
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:375201895"
     variation       1615
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150079355"
     variation       1617
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201540119"
     exon            1641..1733
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1662
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145464697"
     variation       1675
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371827987"
     variation       1676
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17851730"
     variation       1681
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:77592008"
     variation       1728
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:202074494"
     exon            1734..1844
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1738
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116127688"
     variation       1741
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:184637482"
     variation       1751
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:78193744"
     variation       1759
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189147436"
     variation       1765
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368935537"
     variation       1773
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373053634"
     exon            1845..1914
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1854
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111401789"
     variation       1858
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374206617"
     variation       1874
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:371079523"
     exon            1915..1999
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       1946
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142991295"
     variation       1950
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74029947"
     variation       1956
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139000256"
     variation       1991
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200904331"
     exon            2000..9133
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /inference="alignment:Splign:1.39.8"
     variation       2000
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375506150"
     variation       2006
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201203844"
     variation       2013
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200267265"
     variation       2017
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147106119"
     variation       2030
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199793936"
     variation       2046
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113179066"
     variation       2079
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149586205"
     variation       2080
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370942946"
     STS             2118..2352
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="RH18085"
                     /db_xref="UniSTS:34600"
     variation       2118
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147741950"
     variation       2125
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374166259"
     variation       2144
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377476890"
     variation       2169
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:370810519"
     variation       2178
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8029350"
     variation       2185
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145208145"
     variation       2200
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201481330"
     variation       2204
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370285730"
     variation       2209
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3192916"
     variation       2219
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374526376"
     variation       2228
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200625948"
     variation       2244
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371808513"
     variation       2257..2258
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="ct"
                     /db_xref="dbSNP:376216745"
     variation       2296
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:8029539"
     variation       2318
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369238058"
     variation       2388
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146738558"
     variation       2436
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138896117"
     variation       2521
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:149364091"
     variation       2541..2542
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="aagg"
                     /db_xref="dbSNP:376443690"
     variation       2595
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187870077"
     variation       2605
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111900920"
     variation       2634
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143721254"
     variation       2659
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190153281"
     variation       2694
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148077432"
     variation       2801
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2283435"
     variation       2805
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:142748314"
     variation       2845
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:377666592"
     variation       2872
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373021353"
     variation       2906
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146068503"
     variation       2918
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139971102"
     variation       2950
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79471145"
     variation       2955
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376244361"
     variation       3005
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:76670995"
     variation       3009
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:79475253"
     variation       3027
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:182416759"
     variation       3300
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141896541"
     variation       3342..3343
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:140683030"
     variation       3395
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:71762640"
     variation       3473
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150761323"
     variation       3549
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186760778"
     STS             3554..3708
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="STS-N68085"
                     /db_xref="UniSTS:39549"
     variation       3555
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79741476"
     variation       3567
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192692871"
     STS             3575..3707
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="STS-R00701"
                     /db_xref="UniSTS:75967"
     variation       3608
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:185380641"
     variation       3611
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188699413"
     variation       3614
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192840398"
     variation       3636
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:369874910"
     variation       3687
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139149477"
     variation       3708
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149898040"
     variation       3709
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143961318"
     variation       3728
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:111892818"
     variation       3760
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373394280"
     variation       3798
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184984623"
     variation       3837
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188662948"
     variation       3915
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:8036512"
     variation       3926
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:8042607"
     variation       3977
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148647924"
     variation       3992
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144182259"
     variation       4007
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:147781570"
     variation       4011
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:8042649"
     variation       4063
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:142594327"
     variation       4123
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:28552510"
     variation       4158
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4932214"
     variation       4350
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144926917"
     variation       4362
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78806349"
     variation       4456
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181150027"
     variation       4498
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370509147"
     variation       4554
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:151292515"
     variation       4621
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183775907"
     variation       4671
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:140558079"
     variation       4897
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374074422"
     variation       4919
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368301313"
     variation       5048
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77126743"
     variation       5064
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:74029950"
     variation       5099
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187959663"
     variation       5107
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:78907291"
     variation       5118
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:138199716"
     variation       5223..5224
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="tg"
                     /db_xref="dbSNP:147594593"
     variation       5253
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182419623"
     variation       5281
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141322282"
     variation       5379
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187034253"
     variation       5518
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191965781"
     variation       5519
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144977703"
     variation       5530
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:733944"
     variation       5574
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115295866"
     variation       5628
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:181841856"
     variation       5655
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369572349"
     variation       5764
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2240588"
     variation       5792
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141802766"
     STS             5810..6331
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="D15S1499"
                     /db_xref="UniSTS:474501"
     variation       5853
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186028547"
     variation       5917
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144635404"
     variation       6016
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2079594"
     variation       6069
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:200947140"
     variation       6070
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:5814358"
     variation       6070
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75639692"
     variation       6075
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:200878421"
     variation       6082
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:190402433"
     variation       6090
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148025652"
     variation       6138
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141728329"
     variation       6239
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182673335"
     variation       6321
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375867543"
     variation       6333
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140389483"
     variation       6358
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186809584"
     variation       6398
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144313615"
     variation       6452
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147339559"
     variation       6475
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148308475"
     variation       6485
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189690388"
     variation       6487..6488
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:369482115"
     variation       6544
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149842217"
     variation       6574
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:729708"
     variation       6585
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:729707"
     variation       6597
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149014213"
     variation       6604
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77577349"
     variation       6622
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:6496565"
     variation       6665
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:184118580"
     variation       6684
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373232557"
     variation       6697
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:729706"
     variation       6878
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76173219"
     variation       6879
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188675546"
     variation       6921..6922
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:199969725"
     variation       6922
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:369738130"
     variation       6978
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376627772"
     STS             6988..7114
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="G27598"
                     /db_xref="UniSTS:10903"
     variation       7042
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:193233541"
     variation       7065
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:185313657"
     variation       7210
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:9550"
     variation       7212
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:59684439"
     variation       7314
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:200031745"
     variation       7320
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151100720"
     variation       7435..7436
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:200841200"
     variation       7442
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:79118417"
     variation       7450
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187349622"
     variation       7467
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191685010"
     variation       7502..7503
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:375688536"
     variation       7512..7513
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:367862009"
     variation       7512
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:79178069"
     variation       7546
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7179900"
     variation       7557
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:141277044"
     variation       7625
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183821867"
     STS             7637..7808
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="D1S1425"
                     /db_xref="UniSTS:149621"
     variation       7674
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:75857481"
     variation       7700
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:188207112"
     variation       7705
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:75928307"
     variation       7707
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:79907874"
     variation       7732
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:58137913"
     variation       7827
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138798788"
     variation       7852..7853
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:36031072"
     variation       7856
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112615188"
     variation       7892
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180761098"
     variation       7902
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:113106926"
     variation       8018
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:6416547"
     variation       8039
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:140528761"
     variation       8090
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79375214"
     variation       8146
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184374894"
     variation       8149
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044182"
     variation       8161
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127674"
     variation       8170
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1127673"
     variation       8203
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1044178"
     variation       8223
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:114400366"
     variation       8304
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150412361"
     variation       8318
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:11555210"
     variation       8344
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369580096"
     variation       8411..8412
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16949953"
     variation       8414
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:16949949"
     variation       8442
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375850322"
     variation       8457
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138076568"
     variation       8493
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149549561"
     variation       8514
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044170"
     variation       8522
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044166"
     variation       8524
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74029952"
     variation       8532
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:113748815"
     variation       8561
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1044162"
     variation       8561
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374827049"
     variation       8567
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1044161"
     variation       8576
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1044159"
     variation       8596..8613
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="gggggcggcttgctcgct"
                     /db_xref="dbSNP:147885662"
     variation       8604..8621
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="cttgctcgctgggggcgg"
                     /db_xref="dbSNP:377089951"
     variation       8633
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:71405638"
     variation       8646..8647
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34814193"
     variation       8659
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:369226856"
     variation       8664
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:56024153"
     variation       8683
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373636673"
     variation       8689
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:190516934"
     variation       8853
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:143993225"
     variation       8868
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201495527"
     STS             8914..9047
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /standard_name="RH93467"
                     /db_xref="UniSTS:92076"
     variation       9053
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112474293"
     variation       9055
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:79128075"
     variation       9067
                     /gene="ABHD2"
                     /gene_synonym="HS1-2; LABH2; PHPS1-2"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182354050"
ORIGIN      
agccctcctcccctttccccgcccactccgggctggccttatccagtagcgtctgggtccctggactaaagccgtcaaatgtaaccaattgctgaggagctctcccctaagaatcccgcctccactctgaggaacagcttcgctgatcaatggatcccctcctagacgcaatgagcgcgcggggcaagtggagaagcggctgaactgcccaatgaacaagcggtttccgtggttaggggcgtggcagaagcggtcgtcaggggcgtggcggcagttacttgggcggggccggtagcggcgggagctgcactggccaggggttccggctgtatatccatgagcgccgctggcagccggggagctgcaggaaccagactgggggcgagctgagcacctgtagtcaatcacacgcagaaataataatgatacttatgttagaagattgttttgagaagtgcatggagttactacatctgaagcatttagaacagtacctggcacagggttctgtcctcttcatttgcaagccactgctttatccacgagggtgctccctacttatgccagtgaattaatttttggcacagatgaatccttcatatttatctggatttagctggtagcatttgtctcctaagacttggtcacagaggaatccatgtgaccttcaggccttctgctctaaactggcaggagatcctgtttctactcacagcgtccgagggtctggtggccgagccctgaggggcgctgttgctcccaggtggcagaattcagcatcagagagccacacagctgaaagagatggatggcttttaggtttgtttgaataagagatctgacctgaccggcccaactgtacaactcttcaaggaaaattcgtatttgcagtgggaagaataagtaacattgatcaagatgaatgccatgctggagactcccgaactcccagccgtgtttgatggagtgaagctggctgcagtggctgctgtgctgtacgtgatcgtccggtgtttgaacctgaagagccccacagccccacctgacctctacttccaggactcggggctctcacgctttctgctcaagtcctgtcctcttctgaccaaagaatacattccaccgttgatctgggggaaaagtggacacatccagacagccttgtatgggaagatgggaagggtgaggtcgccacatccttatgggcaccggaagttcatcactatgtctgatggagccacttctacattcgacctcttcgagcccttggctgagcactgtgttggagatgatatcaccatggtcatctgccctggaattgccaatcacagcgagaagcaatacatccgcactttcgttgactacgcccagaaaaatggctatcggtgcgccgtgctgaaccacctgggtgccctgcccaacattgaattgacctcgccacgcatgttcacctatggctgcacgtgggaatttggagccatggtgaactacatcaagaagacatatcccctgacccagctggtcgtcgtgggcttcagcctgggtggtaacattgtgtgcaaatacttgggggagactcaggcaaaccaagagaaggtcctgtgctgcgtcagcgtgtgccaggggtacagtgcactgagggcccaggaaaccttcatgcaatgggatcagtgccggcggttctacaacttcctcatggctgacaacatgaagaagatcatcctctcgcacaggcaagctctttttggagaccatgttaagaaaccccagagcctggaagacacggacttgagccggctctacacagcaacatccctgatgcagattgatgacaatgtgatgaggaagtttcacggctataactccctgaaggaatactatgaggaagaaagttgcatgcggtacctgcacaggatttatgttcctctcatgctggttaatgcagctgacgatccgttggtgcatgaaagtcttctaaccattccaaaatctctttcagagaaacgagagaacgtcatgtttgtgctgcctctgcatgggggccacttgggcttctttgagggctctgtgctgttccccgagcccctgacatggatggataagctggtggtggagtacgccaacgccatttgccaatgggagcgtaacaagttgcagtgctctgacacggagcaggtggaggccgacctggagtgaggcctccggactctggcacgctccagcagccctcctctggaagctgcgtcccctcaccccctgtttcaggtctcccatctccctcagtgacctggatctgacctcacaccatcagcagggggcacccaccatgcacacctgtctcggagtaggcagctcttcctgggagctccaggctatttttgtgcttagttactggttttctccattgcattgttaggcatggtgacaagtgacagagttcttgccctctgtccagtttcagcatctggttgcttttaagccaagtacatctagtttccctattaaaaatgtgtctgaatagcgattttgctttgccaccaaaaggcttttccctgagaacagtgaaggatgtatgtcattttgtggtggttgtatgtgtccttacatagaccttaaaaagagctcacccttccaggccaatgctgaagacacagctccgcttgggagcctgagaacccaggcttcccaggccagagtgtggcttcttaaacggcaaaggaaattcctttgagtcacaagccaagttttcgccctgtctcctgagaccatttccctacgctttgctgctgctgagagttacgtgaggcacttgttaaaaattcagcctcccaggtccctcccctcggagaggctgattcactgggtctgggaaggagcctggggattttaatttttcacaagtgccccagatgattctcatcaccaagcaaattttggaaatgctgttcaacagcgcccttaaattggaaacatctttgcagctcgttttattgaaattcataatcaggggtgtcctctagctcccacggtctccagagcagcaaggccggctatggagctgccgtcgtgtgaccacagtgtgatgtctcagaagggctctgggtgggctgagcatctgggctgtgccctggctctgcttttcaccctggacaaagtcgctgtggacttcaatttcttcacctctaaaatgggggacttggaccaggtagattgctgagctcactaccaggttcaaagttcaatgacaaactcagtttactgaggtttgagagaacatccctccaggggagcctgggagctgctctcccagtctaagcatgtagatatcatcgtttgccttttgtgtgtgtgtgtcccttatttgataaaaagatgttttgagttgttttttttttaagcactcacttgtaattttagtttttaaacccaagtccctctaactttgcctttgataccaaacaattcaaaagttggatctgagtttggagaaagatatttccaacctaagtgggtattattttgaaaccagatttttaatttaatagcctatatttgtagtctgttggataggtgtttccaaagtgtgtcttctcaagtgaaaacgcaactctaggtttcaagtactccttttctccgatcctgtggtacttgaatatccaaaaaccctgcactttgaacaatcagctgttgctatctggaactaaacagaactatgagtaaaattgcctggatactttaaaaagatatttttcctccttcatctcctttgactccaggacagactggaatataagtagtgggtctgcatggatgtttcagggatcaaaggagccacctgggcgcctgagtgccaaccctcagggccacaggtgggtgtggtttgggcacgggtccaagtgactgtgacgggacccgtgggcatgggtccaggtctgtaacctgaagaagttgttttctgacaatcaccaaatcatccgaatgacatcaaaagcagcccttatctcagagactgagatttctgtggtctcaacttcgctttggtataatttctggcactcaccagcctctatcattatgactttccccccagtgtattatttctctaataggtttccttttcacgttcttttagcacagactggcactttaccctctcagtttggaagttagcccctctcctctgttacttttcccttcacccaactacagctgtgatctagaacattcatagtcatatttctgctactactaccttcatttatcaagactttttatgagaataggtaaaccaagcaataacttcctaggactgaatcaccaccccagaagagcgagaggctcctttcatatgcctgaggccacaccccttaacctgttctgacaaaatagtggctggcccatgtaccagctccattcagaaattcaggaagagaaaagacagccctgttgtcacacaaaccggtgtgggggagggtggagcctggtctgcacggcagtcctggtggcccctgtggaggacaggcagggctggcagcatagcctttgttgccacacaaccggaatttgctcccccaggactgtgggagccagtgtcccagctgaaatctttttagtgtgtggctctgaatggcactcacattccattttggctcacatgaaactaactgaagccctttgttcaagcttcaggctcttaggcatggaaatgagaatgtgactgtggctgtcttacaggaaaattcttgtttgtccctgaatgagagcacagaggcattgaattcacagagctgcaaacttgcctgataaatgagggagtggcagtttatagataggtcatcttttttccttcctccaggtgtccttgcctttcttcccaaagtcattcatttctgatgagtatatgaatccccctcttgctagtaaggttctatttgggctaaaacaaggctgaatttttaaagagtatttgaatatattttagaatcaaattgaggctataaattgcatcaatctggacaattccattgcaggaataatatgttaaaaaccaatggggagaagcacccacatctctcctgtagcactccgtgtctcataagcaatttgaagacacttacaagtaactgattccagtcaaattaggattaactgactcaaaaaatggtgtcaagtttctttaatgtttttatgttagaagtgagtttaacagacttgaagaaaactgttatcttttcctgctgtgagtttacacaaatgattccagagcagaatgaaagcagaaagctgttggttacaatattcttttaacctctctgcagcattttacacttactgggaaccttatgattcaccgtaagagtggaaatatacctgagttcgtgtcctaatggtctctaattcacattggatcgtgggcaaatcacctcacctctctgagcctgttccctcctcttagaccatctctaagaccacttcatctatttacacatcatttgcttgaacattgctgaacatctgcgtgaacttggcctctccagcccttgcaggtggaaacagctgtgtcaaggctcaaggctcacgctgaggggacttggagggagggggcttctgcattaagctttcctggtgaagacccttgatcttgtccaaagccctgtgtctttgactggcttctcttcagagtccccgttgtcatcgtaagacccttgctgtttggagggtggtcttgtgactgtggcagctgctggccgctggaatgaggagcctatctccatcctccagtgtgactcaggcagagcattgagaattcccagggcagaaatccttcctgctcaggctttcattctaaaactacagtcttcattaaagctgaactttctgggtagctgagcttatatgcccggcatctgaatgagagctctctttgtaactgtgtgacttgagatctagtttgccagctcctgggaaacaatacatgtgttcttgtttgtgtttgctcagcaagcagatgtctgagatgtaagaagcttttcttttcctgtggcattgattctgacttagagctgaagtaaaagatcactgaaacatcacgtcaagttgaagtcactcataggtctttgtcctttaggcaggacaggagagtcattaagaagcatttcactgtagcattctatcacaatatcatctggaattgttttctttgcccagaaagccttaacttgcctctagagaatccctggtattacaacgatattgcggcattagaattccaactcttctgctgtggaagtttgaagcgaagctgcagcaaaaccagagaatttcctcaagtggcctgtaggctccttgttatcttatgcccccacccctccctcaacaatatgagtgatccagaactggcccaaacacctcagctctggtccctttttgcccttcttggccttactctgttgttcaaagccactttggattgcttggatgcttcgaacagccatgaaaagtagcctgcctgtggcatttagaggccaagcaattgacagaaagggtttcttctacctctgttatctaagcagagggaagtaaacctctcaccgccccccacccctcactgcccccgattaccctagaattgctttcgccaaattgtagttgaagctaaggaaggggaatctggcccctgctgggagagggaactggaatgccacacaaggcaaggcctgcttccttccttcccctctgctgctgctgcctcggaacgctgcagcccaggcttcctcccacagtggcccttggaagcaggccgcagagtagacagctgctccttttggaagagtcagtcccctgtgttttctgaactgtttttcctagcatgtatgtgggtagagctttcatgcatctctagtaataataagctgaaattagttttttttttaattctccaatttaaaacttttaattaaaaagtaaattttaatgtcgaaaatgcaaacttggggagggcagaaagatcacacacaaggctgtcacttcatacttgcaggattgcacagcagccgggcagaggcgctcctcacttcccagatggggcggcgggcagcagagacgcacctcacttcctagacagtgcggcagccaggcacaggcacacctcacttcccagacagttgggcggccaggcaagcgctcctcacttcccagatggggcggctcccgggaagcggggctcctcacttcccagacagggtggccaggcagaggtgctcctcacttcccagaacaattctttatgaatttgataaaggactgaagtgcaactgaaagctgctagtgatgatctggtaatatacaatttgtccagtagccagtttgtttttattgtgttttctaaccataagagatcattaaaggcaaagcctgtatgacgctgtacacacacaaaaaaatggtcaccgcaggccatactaccaatgaaatggtaggtaaacaaatcttctggtcaagagaaaaaaaaaagaaatagcactctgcatgctttgctctacaagacgaatttccctagaaagaatccaatgaaggccgggcatagtggctcactcctgtaatcccagcactttggaggccgaggcgggtagatcacctgaggttaggagttcaagaccagcctggccaacatggtgaaaccccttctctactaaaaatgcaaaaattagctgggtgtggtggcgggcgcctgtaatcccagctactcgggaggctgaggtgggagaattgcttgaacccaggagacggaggttgcagtgagccgagatcacgcctctgcactccagcctgggcaacaagagtgagactccgtctccaaaaaaagaaaaggaatccagtgaaaatggctgcaattacaacaagaagtgaaggaagaagactggtgacatctctgaaggatgcagttgaggttgatccaggtttatccgaatatgctacctttctgagccttaaaccttcatctctcaggtgttgatttgcttctgatagcttcatcatttctccctgaagtcttttacactcttctgttagtttccttgtttcagtatcatgaagtgaagcactgtgtggttgtggcgtgggcccgtcttgcttagatgcattcagtgggacagctttgctgggttccatgtcattcaatttatcattttcattggggatctccatttggaatccattaattcatgaggttttgcctcattccacacagcttccatatctgaagtgtttagtggagcaaaaattgtaccataaacttgtgtttactcttttcattcggatcatagtcaaagggctgtagcattactgaaacagtcacagttgaccctgggtcaataattccactgttgggcctcacacagtaccggtgaggcacggtagtcttcactttgaaacacacttttctatccgatggatttcgcaatttaagatttgtagtgactacatctgtgaaggggcctttgaatttgaggtctatgggcgggtcgaggaccaggatctgctcgtgcttcgccgtggccccggaggcagacgccattggagagacagcgcagagcagggggcggcttgctcgctgggggcgggggacgatggcgagaggggagggggagcgagttcgcatctctccttttcctggttagactctgttcaaccacattcttatgttggcagatctgcttccagattgatttttagagcaccatcactttcacattcctgattctgattttgttttgttttgtttgggttttctgaaacttaaaatgctgccccgaaaatactatatttttgagtttgtgttctgaaagcctccgtgctgctggatctttggggggaaatacaggatccttcagcactgaggtgtttaagatttgcaactagcaatgcaattttttctaaatatggggatatttacctttattaagaaattatactaaacattgatgtccttgatcattttatgttctcatattacttttgattctactatgattgtgtggtggtgaacaaagatcattacaaacaaaaactgtaattttgttatatttgattcaatggaatttacctaaaaaataaagactaaaaatgtggtgtgaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:11057 -> Molecular function: GO:0003674 [molecular_function] evidence: ND
            GeneID:11057 -> Molecular function: GO:0004091 [carboxylesterase activity] evidence: IEA
            GeneID:11057 -> Biological process: GO:0008150 [biological_process] evidence: ND
            GeneID:11057 -> Biological process: GO:0009611 [response to wounding] evidence: IEA
            GeneID:11057 -> Biological process: GO:0030336 [negative regulation of cell migration] evidence: IEA
            GeneID:11057 -> Cellular component: GO:0016021 [integral to membrane] evidence: NAS

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.