2024-03-29 18:34:31, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_007008 1808 bp mRNA linear PRI 01-JUL-2013 DEFINITION Homo sapiens reticulon 4 (RTN4), transcript variant 3, mRNA. ACCESSION NM_007008 VERSION NM_007008.2 GI:47519538 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1808) AUTHORS Shi,S., Zhou,B., Wang,Y., Chen,Y., Zhang,K., Wang,K., Quan,Y., Song,Y., Rao,L. and Zhang,L. TITLE Genetic variation in RTN4 3'-UTR and susceptibility to cervical squamous cell carcinoma JOURNAL DNA Cell Biol. 31 (6), 1088-1094 (2012) PUBMED 22320844 REMARK GeneRIF: genetic variation in RTN4 3'-UTR contributes to the susceptibility to CSCC REFERENCE 2 (bases 1 to 1808) AUTHORS Li,H., Chen,Y., Zhou,B., Peng,Y., Bai,W. and Rao,L. TITLE RNT4 3'-UTR insertion/deletion polymorphisms are not associated with atrial septal defect in Chinese Han population: a brief communication JOURNAL DNA Cell Biol. 31 (6), 1121-1124 (2012) PUBMED 22313113 REMARK GeneRIF: CAA and TATC insertion/deletion polymorphisms of RNT4 gene may not be a useful marker to predict the susceptibility of ASD in Chinese Han population REFERENCE 3 (bases 1 to 1808) AUTHORS Marucci,G., Di Oto,E., Farnedi,A., Panzacchi,R., Ligorio,C. and Foschini,M.P. TITLE Nogo-A: a useful marker for the diagnosis of oligodendroglioma and for identifying 1p19q codeletion JOURNAL Hum. Pathol. 43 (3), 374-380 (2012) PUBMED 21835431 REMARK GeneRIF: Nogo-A is a useful marker for the diagnosis of oligodendroglioma and for identifying 1p19q codeletion REFERENCE 4 (bases 1 to 1808) AUTHORS Haybaeck,J., Llenos,I.C., Dulay,R.J., Bettermann,K., Miller,C.L., Walchli,T., Frei,K., Virgintino,D., Rizzi,M. and Weis,S. TITLE Expression of nogo-a is decreased with increasing gestational age in the human fetal brain JOURNAL Dev. Neurosci. 34 (5), 402-416 (2012) PUBMED 23146900 REMARK GeneRIF: The results demonstrate a significant change in the expression of Nogo-A during the development of the human brain REFERENCE 5 (bases 1 to 1808) AUTHORS Zhang,L., Kuang,X. and Zhang,J. TITLE Nogo receptor 3, a paralog of Nogo-66 receptor 1 (NgR1), may function as a NgR1 co-receptor for Nogo-66 JOURNAL J Genet Genomics 38 (11), 515-523 (2011) PUBMED 22133682 REMARK GeneRIF: Nogo receptor 3, a paralog of NgR1,functions as a NgR1 co-receptor for Nogo-66. REFERENCE 6 (bases 1 to 1808) AUTHORS Tagami,S., Eguchi,Y., Kinoshita,M., Takeda,M. and Tsujimoto,Y. TITLE A novel protein, RTN-XS, interacts with both Bcl-XL and Bcl-2 on endoplasmic reticulum and reduces their anti-apoptotic activity JOURNAL Oncogene 19 (50), 5736-5746 (2000) PUBMED 11126360 REFERENCE 7 (bases 1 to 1808) AUTHORS GrandPre,T., Nakamura,F., Vartanian,T. and Strittmatter,S.M. TITLE Identification of the Nogo inhibitor of axon regeneration as a Reticulon protein JOURNAL Nature 403 (6768), 439-444 (2000) PUBMED 10667797 REFERENCE 8 (bases 1 to 1808) AUTHORS Chen,M.S., Huber,A.B., van der Haar,M.E., Frank,M., Schnell,L., Spillmann,A.A., Christ,F. and Schwab,M.E. TITLE Nogo-A is a myelin-associated neurite outgrowth inhibitor and an antigen for monoclonal antibody IN-1 JOURNAL Nature 403 (6768), 434-439 (2000) PUBMED 10667796 REFERENCE 9 (bases 1 to 1808) AUTHORS Prinjha,R., Moore,S.E., Vinson,M., Blake,S., Morrow,R., Christie,G., Michalovich,D., Simmons,D.L. and Walsh,F.S. TITLE Inhibitor of neurite outgrowth in humans JOURNAL Nature 403 (6768), 383-384 (2000) PUBMED 10667780 REFERENCE 10 (bases 1 to 1808) AUTHORS Yang,J., Yu,L., Bi,A.D. and Zhao,S.Y. TITLE Assignment of the human reticulon 4 gene (RTN4) to chromosome 2p14-->2p13 by radiation hybrid mapping JOURNAL Cytogenet. Cell Genet. 88 (1-2), 101-102 (2000) PUBMED 10773680 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AY102276.1, AF125103.1, AF132048.1 and AI671568.1. On May 19, 2004 this sequence version replaced gi:5902015. Summary: This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]. Transcript Variant: This variant (3), also known as Foocen-S and Nogo-C, differs in the 5' UTR and the 5' coding region, compared to variant 1. The resulting isoform (C) contains a distinct N-terminus, compared to isoform A. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF125103.1, BC014366.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025088 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1063 AY102276.1 21-1083 1064-1508 AF125103.1 1064-1508 1509-1766 AF132048.1 1407-1664 1767-1808 AI671568.1 1-42 c FEATURES Location/Qualifiers source 1..1808 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" /map="2p16.3" gene 1..1808 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /note="reticulon 4" /db_xref="GeneID:57142" /db_xref="HGNC:14085" /db_xref="MIM:604475" exon 1..248 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /inference="alignment:Splign:1.39.8" misc_feature 206..208 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /note="upstream in-frame stop codon" CDS 215..814 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /note="isoform C is encoded by transcript variant 3; neuroendocrine-specific protein C homolog; neurite outgrowth inhibitor; foocen; reticulon 5; My043 protein; neurite growth inhibitor 220; Human NogoA" /codon_start=1 /product="reticulon-4 isoform C" /protein_id="NP_008939.1" /db_xref="GI:5902016" /db_xref="CCDS:CCDS42685.1" /db_xref="GeneID:57142" /db_xref="HGNC:14085" /db_xref="MIM:604475" /translation="
MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE
" misc_feature 248..760 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /note="Reticulon; Region: Reticulon; pfam02453" /db_xref="CDD:217046" exon 249..456 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /inference="alignment:Splign:1.39.8" variation 430 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /replace="a" /replace="g" /db_xref="dbSNP:3916038" exon 457..595 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /inference="alignment:Splign:1.39.8" exon 596..665 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /inference="alignment:Splign:1.39.8" exon 666..712 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /inference="alignment:Splign:1.39.8" exon 713..771 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /inference="alignment:Splign:1.39.8" exon 772..1781 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /inference="alignment:Splign:1.39.8" variation 845 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /replace="a" /replace="c" /db_xref="dbSNP:1801912" STS 867..1003 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /standard_name="RH11556" /db_xref="UniSTS:19351" variation 894 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /replace="c" /replace="t" /db_xref="dbSNP:1801911" STS 979..1157 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /standard_name="D2S1981" /db_xref="UniSTS:62317" STS 1062..1131 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /standard_name="SHGC-5636" /db_xref="UniSTS:3994" polyA_signal 1081..1086 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" polyA_site 1174 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /experiment="experimental evidence, no additional details recorded" STS 1476..1584 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /standard_name="A002P20" /db_xref="UniSTS:11346" STS 1599..1741 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" /standard_name="AB049853" /db_xref="UniSTS:480168" polyA_signal 1760..1765 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" polyA_site 1781 /gene="RTN4" /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C" ORIGIN
agcctagttacagattgcactgcgtcagactgttccacacccagaagacgtcaggtgacttcagtcctgctgcagttgtgcagcagaggagactgcagacttcggttgaggaaacgggtatttcatgtctcagggagtaggtttgtgcagttacagcttttctgttggtatgcataattaataattggagctgcaaagcagatcgtgacaagagatggacggtcagaagaaaaattggaaggacaaggttgttgacctcctgtactggagagacattaagaagactggagtggtgtttggtgccagcctattcctgctgctttcattgacagtattcagcattgtgagcgtaacagcctacattgccttggccctgctctctgtgaccatcagctttaggatatacaagggtgtgatccaagctatccagaaatcagatgaaggccacccattcagggcatatctggaatctgaagttgctatatctgaggagttggttcagaagtacagtaattctgctcttggtcatgtgaactgcacgataaaggaactcaggcgcctcttcttagttgatgatttagttgattctctgaagtttgcagtgttgatgtgggtatttacctatgttggtgccttgtttaatggtctgacactactgattttggctctcatttcactcttcagtgttcctgttatttatgaacggcatcaggcacagatagatcattatctaggacttgcaaataagaatgttaaagatgctatggctaaaatccaagcaaaaatccctggattgaagcgcaaagctgaatgaaaacgcccaaaataattagtaggagttcatctttaaaggggatattcatttgattatacgggggagggtcagggaagaacgaaccttgacgttgcagtgcagtttcacagatcgttgttagatctttatttttagccatgcactgttgtgaggaaaaattacctgtcttgactgccatgtgttcatcatcttaagtattgtaagctgctatgtatggatttaaaccgtaatcatatctttttcctatctatctgaggcactggtggaataaaaaacctgtatattttactttgttgcagatagtcttgccgcatcttggcaagttgcagagatggtggagctagaaaaaaaaaaaaaaaagcccttttcagtttgtgcactgtgtatggtccgtgtagattgatgcagattttctgaaatgaaatgtttgtttagacgagatcataccggtaaagcaggaatgacaaagcttgcttttctggtatgttctaggtgtattgtgacttttactgttatattaattgccaatataagtaaatatagattatatatgtatagtgtttcacaaagcttagacctttaccttccagccaccccacagtgcttgatatttcagagtcagtcattggttatacatgtgtagttccaaagcacataagctagaagaagaaatatttctaggagcactaccatctgttttcaacatgaaatgccacacacatagaactccaacatcaatttcattgcacagactgactgtagttaattttgtcacagaatctatggactgaatctaatgcttccaaaaatgttgtttgtttgcaaatatcaaacattgttatgcaagaaattattaattacaaaatgaagatttataccattgtggtttaagctgtactgaactaaatctgtggaatgcattgtgaactgtaaaagcaaagtatcaataaagcttatagacttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:57142 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:57142 -> Biological process: GO:0001525 [angiogenesis] evidence: IEA GeneID:57142 -> Biological process: GO:0006915 [apoptotic process] evidence: NAS GeneID:57142 -> Biological process: GO:0007413 [axonal fasciculation] evidence: ISS GeneID:57142 -> Biological process: GO:0021801 [cerebral cortex radial glia guided migration] evidence: ISS GeneID:57142 -> Biological process: GO:0030308 [negative regulation of cell growth] evidence: IMP GeneID:57142 -> Biological process: GO:0030334 [regulation of cell migration] evidence: IDA GeneID:57142 -> Biological process: GO:0030517 [negative regulation of axon extension] evidence: IDA GeneID:57142 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: NAS GeneID:57142 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS GeneID:57142 -> Biological process: GO:0050770 [regulation of axonogenesis] evidence: TAS GeneID:57142 -> Biological process: GO:0050771 [negative regulation of axonogenesis] evidence: TAS GeneID:57142 -> Biological process: GO:0060317 [cardiac epithelial to mesenchymal transition] evidence: IEA GeneID:57142 -> Biological process: GO:0071786 [endoplasmic reticulum tubular network organization] evidence: IMP GeneID:57142 -> Biological process: GO:2000172 [regulation of branching morphogenesis of a nerve] evidence: ISS GeneID:57142 -> Cellular component: GO:0005635 [nuclear envelope] evidence: IDA GeneID:57142 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: NAS GeneID:57142 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS GeneID:57142 -> Cellular component: GO:0030176 [integral to endoplasmic reticulum membrane] evidence: IDA GeneID:57142 -> Cellular component: GO:0042995 [cell projection] evidence: IEA GeneID:57142 -> Cellular component: GO:0043025 [neuronal cell body] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.