GGRNA Home | Help | Advanced search

2024-03-29 18:34:31, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_007008               1808 bp    mRNA    linear   PRI 01-JUL-2013
DEFINITION  Homo sapiens reticulon 4 (RTN4), transcript variant 3, mRNA.
ACCESSION   NM_007008
VERSION     NM_007008.2  GI:47519538
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1808)
  AUTHORS   Shi,S., Zhou,B., Wang,Y., Chen,Y., Zhang,K., Wang,K., Quan,Y.,
            Song,Y., Rao,L. and Zhang,L.
  TITLE     Genetic variation in RTN4 3'-UTR and susceptibility to cervical
            squamous cell carcinoma
  JOURNAL   DNA Cell Biol. 31 (6), 1088-1094 (2012)
   PUBMED   22320844
  REMARK    GeneRIF: genetic variation in RTN4 3'-UTR contributes to the
            susceptibility to CSCC
REFERENCE   2  (bases 1 to 1808)
  AUTHORS   Li,H., Chen,Y., Zhou,B., Peng,Y., Bai,W. and Rao,L.
  TITLE     RNT4 3'-UTR insertion/deletion polymorphisms are not associated
            with atrial septal defect in Chinese Han population: a brief
            communication
  JOURNAL   DNA Cell Biol. 31 (6), 1121-1124 (2012)
   PUBMED   22313113
  REMARK    GeneRIF: CAA and TATC insertion/deletion polymorphisms of RNT4 gene
            may not be a useful marker to predict the susceptibility of ASD in
            Chinese Han population
REFERENCE   3  (bases 1 to 1808)
  AUTHORS   Marucci,G., Di Oto,E., Farnedi,A., Panzacchi,R., Ligorio,C. and
            Foschini,M.P.
  TITLE     Nogo-A: a useful marker for the diagnosis of oligodendroglioma and
            for identifying 1p19q codeletion
  JOURNAL   Hum. Pathol. 43 (3), 374-380 (2012)
   PUBMED   21835431
  REMARK    GeneRIF: Nogo-A is a useful marker for the diagnosis of
            oligodendroglioma and for identifying 1p19q codeletion
REFERENCE   4  (bases 1 to 1808)
  AUTHORS   Haybaeck,J., Llenos,I.C., Dulay,R.J., Bettermann,K., Miller,C.L.,
            Walchli,T., Frei,K., Virgintino,D., Rizzi,M. and Weis,S.
  TITLE     Expression of nogo-a is decreased with increasing gestational age
            in the human fetal brain
  JOURNAL   Dev. Neurosci. 34 (5), 402-416 (2012)
   PUBMED   23146900
  REMARK    GeneRIF: The results demonstrate a significant change in the
            expression of Nogo-A during the development of the human brain
REFERENCE   5  (bases 1 to 1808)
  AUTHORS   Zhang,L., Kuang,X. and Zhang,J.
  TITLE     Nogo receptor 3, a paralog of Nogo-66 receptor 1 (NgR1), may
            function as a NgR1 co-receptor for Nogo-66
  JOURNAL   J Genet Genomics 38 (11), 515-523 (2011)
   PUBMED   22133682
  REMARK    GeneRIF: Nogo receptor 3, a paralog of NgR1,functions as a NgR1
            co-receptor for Nogo-66.
REFERENCE   6  (bases 1 to 1808)
  AUTHORS   Tagami,S., Eguchi,Y., Kinoshita,M., Takeda,M. and Tsujimoto,Y.
  TITLE     A novel protein, RTN-XS, interacts with both Bcl-XL and Bcl-2 on
            endoplasmic reticulum and reduces their anti-apoptotic activity
  JOURNAL   Oncogene 19 (50), 5736-5746 (2000)
   PUBMED   11126360
REFERENCE   7  (bases 1 to 1808)
  AUTHORS   GrandPre,T., Nakamura,F., Vartanian,T. and Strittmatter,S.M.
  TITLE     Identification of the Nogo inhibitor of axon regeneration as a
            Reticulon protein
  JOURNAL   Nature 403 (6768), 439-444 (2000)
   PUBMED   10667797
REFERENCE   8  (bases 1 to 1808)
  AUTHORS   Chen,M.S., Huber,A.B., van der Haar,M.E., Frank,M., Schnell,L.,
            Spillmann,A.A., Christ,F. and Schwab,M.E.
  TITLE     Nogo-A is a myelin-associated neurite outgrowth inhibitor and an
            antigen for monoclonal antibody IN-1
  JOURNAL   Nature 403 (6768), 434-439 (2000)
   PUBMED   10667796
REFERENCE   9  (bases 1 to 1808)
  AUTHORS   Prinjha,R., Moore,S.E., Vinson,M., Blake,S., Morrow,R.,
            Christie,G., Michalovich,D., Simmons,D.L. and Walsh,F.S.
  TITLE     Inhibitor of neurite outgrowth in humans
  JOURNAL   Nature 403 (6768), 383-384 (2000)
   PUBMED   10667780
REFERENCE   10 (bases 1 to 1808)
  AUTHORS   Yang,J., Yu,L., Bi,A.D. and Zhao,S.Y.
  TITLE     Assignment of the human reticulon 4 gene (RTN4) to chromosome
            2p14-->2p13 by radiation hybrid mapping
  JOURNAL   Cytogenet. Cell Genet. 88 (1-2), 101-102 (2000)
   PUBMED   10773680
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AY102276.1, AF125103.1,
            AF132048.1 and AI671568.1.
            On May 19, 2004 this sequence version replaced gi:5902015.
            
            Summary: This gene belongs to the family of reticulon encoding
            genes. Reticulons are associated with the endoplasmic reticulum,
            and are involved in neuroendocrine secretion or in membrane
            trafficking in neuroendocrine cells. The product of this gene is a
            potent neurite outgrowth inhibitor which may also help block the
            regeneration of the central nervous system in higher vertebrates.
            Alternatively spliced transcript variants derived both from
            differential splicing and differential promoter usage and encoding
            different isoforms have been identified. [provided by RefSeq, Jul
            2008].
            
            Transcript Variant: This variant (3), also known as Foocen-S and
            Nogo-C, differs in the 5' UTR and the 5' coding region, compared to
            variant 1. The resulting isoform (C) contains a distinct
            N-terminus, compared to isoform A.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF125103.1, BC014366.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-1063              AY102276.1         21-1083
            1064-1508           AF125103.1         1064-1508
            1509-1766           AF132048.1         1407-1664
            1767-1808           AI671568.1         1-42                c
FEATURES             Location/Qualifiers
     source          1..1808
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p16.3"
     gene            1..1808
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /note="reticulon 4"
                     /db_xref="GeneID:57142"
                     /db_xref="HGNC:14085"
                     /db_xref="MIM:604475"
     exon            1..248
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    206..208
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /note="upstream in-frame stop codon"
     CDS             215..814
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /note="isoform C is encoded by transcript variant 3;
                     neuroendocrine-specific protein C homolog; neurite
                     outgrowth inhibitor; foocen; reticulon 5; My043 protein;
                     neurite growth inhibitor 220; Human NogoA"
                     /codon_start=1
                     /product="reticulon-4 isoform C"
                     /protein_id="NP_008939.1"
                     /db_xref="GI:5902016"
                     /db_xref="CCDS:CCDS42685.1"
                     /db_xref="GeneID:57142"
                     /db_xref="HGNC:14085"
                     /db_xref="MIM:604475"
                     /translation="
MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE
"
     misc_feature    248..760
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /note="Reticulon; Region: Reticulon; pfam02453"
                     /db_xref="CDD:217046"
     exon            249..456
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /inference="alignment:Splign:1.39.8"
     variation       430
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3916038"
     exon            457..595
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /inference="alignment:Splign:1.39.8"
     exon            596..665
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /inference="alignment:Splign:1.39.8"
     exon            666..712
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /inference="alignment:Splign:1.39.8"
     exon            713..771
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /inference="alignment:Splign:1.39.8"
     exon            772..1781
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /inference="alignment:Splign:1.39.8"
     variation       845
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1801912"
     STS             867..1003
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /standard_name="RH11556"
                     /db_xref="UniSTS:19351"
     variation       894
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1801911"
     STS             979..1157
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /standard_name="D2S1981"
                     /db_xref="UniSTS:62317"
     STS             1062..1131
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /standard_name="SHGC-5636"
                     /db_xref="UniSTS:3994"
     polyA_signal    1081..1086
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
     polyA_site      1174
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /experiment="experimental evidence, no additional details
                     recorded"
     STS             1476..1584
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /standard_name="A002P20"
                     /db_xref="UniSTS:11346"
     STS             1599..1741
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
                     /standard_name="AB049853"
                     /db_xref="UniSTS:480168"
     polyA_signal    1760..1765
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
     polyA_site      1781
                     /gene="RTN4"
                     /gene_synonym="ASY; Nbla00271; Nbla10545; NI220/250; NOGO;
                     NOGO-A; Nogo-B; Nogo-C; NOGOC; NSP; NSP-CL; RTN-X; RTN4-A;
                     RTN4-B1; RTN4-B2; RTN4-C"
ORIGIN      
agcctagttacagattgcactgcgtcagactgttccacacccagaagacgtcaggtgacttcagtcctgctgcagttgtgcagcagaggagactgcagacttcggttgaggaaacgggtatttcatgtctcagggagtaggtttgtgcagttacagcttttctgttggtatgcataattaataattggagctgcaaagcagatcgtgacaagagatggacggtcagaagaaaaattggaaggacaaggttgttgacctcctgtactggagagacattaagaagactggagtggtgtttggtgccagcctattcctgctgctttcattgacagtattcagcattgtgagcgtaacagcctacattgccttggccctgctctctgtgaccatcagctttaggatatacaagggtgtgatccaagctatccagaaatcagatgaaggccacccattcagggcatatctggaatctgaagttgctatatctgaggagttggttcagaagtacagtaattctgctcttggtcatgtgaactgcacgataaaggaactcaggcgcctcttcttagttgatgatttagttgattctctgaagtttgcagtgttgatgtgggtatttacctatgttggtgccttgtttaatggtctgacactactgattttggctctcatttcactcttcagtgttcctgttatttatgaacggcatcaggcacagatagatcattatctaggacttgcaaataagaatgttaaagatgctatggctaaaatccaagcaaaaatccctggattgaagcgcaaagctgaatgaaaacgcccaaaataattagtaggagttcatctttaaaggggatattcatttgattatacgggggagggtcagggaagaacgaaccttgacgttgcagtgcagtttcacagatcgttgttagatctttatttttagccatgcactgttgtgaggaaaaattacctgtcttgactgccatgtgttcatcatcttaagtattgtaagctgctatgtatggatttaaaccgtaatcatatctttttcctatctatctgaggcactggtggaataaaaaacctgtatattttactttgttgcagatagtcttgccgcatcttggcaagttgcagagatggtggagctagaaaaaaaaaaaaaaaagcccttttcagtttgtgcactgtgtatggtccgtgtagattgatgcagattttctgaaatgaaatgtttgtttagacgagatcataccggtaaagcaggaatgacaaagcttgcttttctggtatgttctaggtgtattgtgacttttactgttatattaattgccaatataagtaaatatagattatatatgtatagtgtttcacaaagcttagacctttaccttccagccaccccacagtgcttgatatttcagagtcagtcattggttatacatgtgtagttccaaagcacataagctagaagaagaaatatttctaggagcactaccatctgttttcaacatgaaatgccacacacatagaactccaacatcaatttcattgcacagactgactgtagttaattttgtcacagaatctatggactgaatctaatgcttccaaaaatgttgtttgtttgcaaatatcaaacattgttatgcaagaaattattaattacaaaatgaagatttataccattgtggtttaagctgtactgaactaaatctgtggaatgcattgtgaactgtaaaagcaaagtatcaataaagcttatagacttaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:57142 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:57142 -> Biological process: GO:0001525 [angiogenesis] evidence: IEA
            GeneID:57142 -> Biological process: GO:0006915 [apoptotic process] evidence: NAS
            GeneID:57142 -> Biological process: GO:0007413 [axonal fasciculation] evidence: ISS
            GeneID:57142 -> Biological process: GO:0021801 [cerebral cortex radial glia guided migration] evidence: ISS
            GeneID:57142 -> Biological process: GO:0030308 [negative regulation of cell growth] evidence: IMP
            GeneID:57142 -> Biological process: GO:0030334 [regulation of cell migration] evidence: IDA
            GeneID:57142 -> Biological process: GO:0030517 [negative regulation of axon extension] evidence: IDA
            GeneID:57142 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: NAS
            GeneID:57142 -> Biological process: GO:0048011 [neurotrophin TRK receptor signaling pathway] evidence: TAS
            GeneID:57142 -> Biological process: GO:0050770 [regulation of axonogenesis] evidence: TAS
            GeneID:57142 -> Biological process: GO:0050771 [negative regulation of axonogenesis] evidence: TAS
            GeneID:57142 -> Biological process: GO:0060317 [cardiac epithelial to mesenchymal transition] evidence: IEA
            GeneID:57142 -> Biological process: GO:0071786 [endoplasmic reticulum tubular network organization] evidence: IMP
            GeneID:57142 -> Biological process: GO:2000172 [regulation of branching morphogenesis of a nerve] evidence: ISS
            GeneID:57142 -> Cellular component: GO:0005635 [nuclear envelope] evidence: IDA
            GeneID:57142 -> Cellular component: GO:0005783 [endoplasmic reticulum] evidence: NAS
            GeneID:57142 -> Cellular component: GO:0005886 [plasma membrane] evidence: TAS
            GeneID:57142 -> Cellular component: GO:0030176 [integral to endoplasmic reticulum membrane] evidence: IDA
            GeneID:57142 -> Cellular component: GO:0042995 [cell projection] evidence: IEA
            GeneID:57142 -> Cellular component: GO:0043025 [neuronal cell body] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.