Home |
Help |
Advanced search
2024-04-26 11:16:17, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_006826 2272 bp mRNA linear PRI 21-JUN-2013
DEFINITION Homo sapiens tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, theta polypeptide (YWHAQ), mRNA.
ACCESSION NM_006826
VERSION NM_006826.3 GI:514052668
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2272)
AUTHORS Leto,D., Uhm,M., Williams,A., Chen,X.W. and Saltiel,A.R.
TITLE Negative regulation of the RalGAP complex by 14-3-3
JOURNAL J. Biol. Chem. 288 (13), 9272-9283 (2013)
PUBMED 23386617
REMARK GeneRIF: 14-3-3 negatively regulates the RGC downstream of the
PI3-kinase/Akt signaling pathway
REFERENCE 2 (bases 1 to 2272)
AUTHORS Sluchanko,N.N. and Gusev,N.B.
TITLE Oligomeric structure of 14-3-3 protein: what do we know about
monomers?
JOURNAL FEBS Lett. 586 (24), 4249-4256 (2012)
PUBMED 23159940
REMARK GeneRIF: this mini-review attempts to collect and to describe the
data concerning monomers of 14-3-3.[review]
Review article
REFERENCE 3 (bases 1 to 2272)
AUTHORS Ito,M., Urano,T., Hiroi,H., Momoeda,M., Saito,M., Hosokawa,Y.,
Tsutsumi,R., Zenri,F., Koizumi,M., Nakae,H., Horie-Inoue,K.,
Fujii,T., Yano,T., Kozuma,S., Inoue,S. and Taketani,Y.
TITLE The progesterone-responsive gene 14-3-3tau enhances the
transcriptional activity of progesterone receptor in uterine cells
JOURNAL J. Mol. Endocrinol. 49 (3), 193-202 (2012)
PUBMED 22967481
REMARK GeneRIF: Data demonstrated that 14-3-3tau enhances the
transcriptional activity of PR-B.
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 2272)
AUTHORS Stoeck,K., Sanchez-Juan,P., Gawinecka,J., Green,A., Ladogana,A.,
Pocchiari,M., Sanchez-Valle,R., Mitrova,E., Sklaviadis,T.,
Kulczycki,J., Slivarichova,D., Saiz,A., Calero,M., Knight,R.,
Aguzzi,A., Laplanche,J.L., Peoc'h,K., Schelzke,G., Karch,A., van
Duijn,C.M. and Zerr,I.
TITLE Cerebrospinal fluid biomarker supported diagnosis of
Creutzfeldt-Jakob disease and rapid dementias: a longitudinal
multicentre study over 10 years
JOURNAL Brain 135 (PT 10), 3051-3061 (2012)
PUBMED 23012332
REMARK GeneRIF: Cerebrospinal fluid protein 14-3-3 detection remains an
important test in the diagnosis of Creutzfeldt-Jakob disease.
REFERENCE 5 (bases 1 to 2272)
AUTHORS Sun,P., Song,J., Zhang,J., Song,Q.Q., Gan,X., Cui,Y., Gao,C.,
Bo,X.Z. and Han,J.
TITLE [Degradation of 14-3-3beta appeared in apoptosis cell induced by
PrP106-126 polypeptide]
JOURNAL Bing Du Xue Bao 28 (4), 414-417 (2012)
PUBMED 22978167
REMARK GeneRIF: egradation of antiapoptosis protein 143-3beta induced by
PrP106-126 peptide may be one of pathogenesis mechanism of prion
disease
REFERENCE 6 (bases 1 to 2272)
AUTHORS Liu,Y.C., Elly,C., Yoshida,H., Bonnefoy-Berard,N. and Altman,A.
TITLE Activation-modulated association of 14-3-3 proteins with Cbl in T
cells
JOURNAL J. Biol. Chem. 271 (24), 14591-14595 (1996)
PUBMED 8663231
REFERENCE 7 (bases 1 to 2272)
AUTHORS Bonnefoy-Berard,N., Liu,Y.C., von Willebrand,M., Sung,A., Elly,C.,
Mustelin,T., Yoshida,H., Ishizaka,K. and Altman,A.
TITLE Inhibition of phosphatidylinositol 3-kinase activity by association
with 14-3-3 proteins in T cells
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 92 (22), 10142-10146 (1995)
PUBMED 7479742
REFERENCE 8 (bases 1 to 2272)
AUTHORS Xiao,B., Smerdon,S.J., Jones,D.H., Dodson,G.G., Soneji,Y.,
Aitken,A. and Gamblin,S.J.
TITLE Structure of a 14-3-3 protein and implications for coordination of
multiple signalling pathways
JOURNAL Nature 376 (6536), 188-191 (1995)
PUBMED 7603573
REFERENCE 9 (bases 1 to 2272)
AUTHORS Leffers,H., Madsen,P., Rasmussen,H.H., Honore,B., Andersen,A.H.,
Walbum,E., Vandekerckhove,J. and Celis,J.E.
TITLE Molecular cloning and expression of the transformation sensitive
epithelial marker stratifin. A member of a protein family that has
been involved in the protein kinase C signalling pathway
JOURNAL J. Mol. Biol. 231 (4), 982-998 (1993)
PUBMED 8515476
REFERENCE 10 (bases 1 to 2272)
AUTHORS Nielsen,P.J.
TITLE Primary structure of a human protein kinase regulator protein
JOURNAL Biochim. Biophys. Acta 1088 (3), 425-428 (1991)
PUBMED 2015305
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from HY044745.1, BC093019.1,
BC050601.1 and AA729400.1.
On Jun 21, 2013 this sequence version replaced gi:21464103.
Summary: This gene product belongs to the 14-3-3 family of proteins
which mediate signal transduction by binding to
phosphoserine-containing proteins. This highly conserved protein
family is found in both plants and mammals, and this protein is 99%
identical to the mouse and rat orthologs. This gene is upregulated
in patients with amyotrophic lateral sclerosis. It contains in its
5' UTR a 6 bp tandem repeat sequence which is polymorphic, however,
there is no correlation between the repeat number and the disease.
[provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC056867.1, X57347.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-58 HY044745.1 3-60
59-1606 BC093019.1 1-1548
1607-2244 BC050601.1 1420-2057
2245-2272 AA729400.1 371-398
FEATURES Location/Qualifiers
source 1..2272
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2p25.1"
gene 1..2272
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/note="tyrosine 3-monooxygenase/tryptophan 5-monooxygenase
activation protein, theta polypeptide"
/db_xref="GeneID:10971"
/db_xref="HGNC:12854"
/db_xref="HPRD:00886"
/db_xref="MIM:609009"
exon 1..115
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/inference="alignment:Splign:1.39.8"
misc_feature 111..113
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/note="upstream in-frame stop codon"
exon 116..491
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/inference="alignment:Splign:1.39.8"
CDS 198..935
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/note="14-3-3 protein tau; 14-3-3 protein T-cell"
/codon_start=1
/product="14-3-3 protein theta"
/protein_id="NP_006817.1"
/db_xref="GI:5803227"
/db_xref="CCDS:CCDS1666.1"
/db_xref="GeneID:10971"
/db_xref="HGNC:12854"
/db_xref="HPRD:00886"
/db_xref="MIM:609009"
/translation="
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
"
misc_feature 198..884
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/note="14-3-3 theta/tau (theta in mice, tau in human), an
isoform of 14-3-3 protein; Region: 14-3-3_theta; cd10023"
/db_xref="CDD:206759"
misc_feature 198..200
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="N-acetylmethionine; propagated from
UniProtKB/Swiss-Prot (P27348.1); acetylation site"
misc_feature 204..206
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P27348.1); acetylation site"
misc_feature order(219..224,234..236,240..245,249..251,258..260,
369..371,378..380,390..392,429..431,441..443,462..464)
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:206759"
misc_feature 270..272
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="S-nitrosylation site; modified site"
misc_feature order(342..344,363..365,555..557,576..581,702..704,
711..716,723..725,732..737,855..857,867..869,876..881)
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/note="peptide binding site [polypeptide binding]; other
site"
/db_xref="CDD:206759"
misc_feature 342..344
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P27348.1); acetylation site"
misc_feature 363..365
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="Interaction with phosphoserine on interacting
protein; propagated from UniProtKB/Swiss-Prot (P27348.1);
other site"
misc_feature 399..401
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P27348.1); acetylation site"
misc_feature 540..542
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="N6-acetyllysine; propagated from
UniProtKB/Swiss-Prot (P27348.1); acetylation site"
misc_feature 576..578
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="Interaction with phosphoserine on interacting
protein; propagated from UniProtKB/Swiss-Prot (P27348.1);
other site"
misc_feature 885..887
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 891..893
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P27348.1); phosphorylation site"
misc_feature 891..893
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:02739"
misc_feature 891..893
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:01044"
exon 492..615
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/inference="alignment:Splign:1.39.8"
exon 616..779
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/inference="alignment:Splign:1.39.8"
exon 780..875
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/inference="alignment:Splign:1.39.8"
exon 876..2254
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/inference="alignment:Splign:1.39.8"
STS 1170..2053
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/standard_name="YWHAQ_1656"
/db_xref="UniSTS:277872"
STS 1664..1916
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/standard_name="RH126547"
/db_xref="UniSTS:208786"
STS 1902..2098
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/db_xref="UniSTS:5184"
STS 1964..2125
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/standard_name="RH15607"
/db_xref="UniSTS:92785"
STS 1974..2123
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/standard_name="RH70237"
/db_xref="UniSTS:90561"
STS 2075..2175
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/standard_name="D22S1126"
/db_xref="UniSTS:89512"
STS 2083..2207
/gene="YWHAQ"
/gene_synonym="14-3-3; 1C5; HS1"
/standard_name="D10S2166"
/db_xref="UniSTS:2906"
ORIGIN
ttgggcggtggaccgcccctcggccccggggtaggctgacacgggagggtcctcagctaaagccaaaagcagatcaaagtggtgggactcgcgtcgcggccgcggagacgtgaagctctcgaggctcctcccgctgcgggtcggcgctcgccctcgctctcctcgccctccgccccggccccggccccgcgcccgccatggagaagactgagctgatccagaaggccaagctggccgagcaggccgagcgctacgacgacatggccacctgcatgaaggcagtgaccgagcagggcgccgagctgtccaacgaggagcgcaacctgctctccgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagggtcatctctagcatcgagcagaagaccgacacctccgacaagaagttgcagctgattaaggactatcgggagaaagtggagtccgagctgagatccatctgcaccacggtgctggaattgttggataaatatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaaatgaagggtgattacttccggtaccttgctgaagttgcgtgtggtgatgatcgaaaacaaacgatagataattcccaaggagcttaccaagaggcatttgatataagcaagaaagagatgcaacccacacacccaatccgcctggggcttgctcttaacttttctgtattttactatgagattcttaataacccagagcttgcctgcacgctggctaaaacggcttttgatgaggccattgctgaacttgatacactgaatgaagactcatacaaagacagcaccctcatcatgcagttgcttagagacaacctaacactttggacatcagacagtgcaggagaagaatgtgatgcggcagaaggggctgaaaactaaatccatacagggtgtcatccttctttccttcaagaaacctttttacacatctccattccttattccacttggatttcctatagcaaagaaacccattcatgtgtatggaatcaactgtttatagtcttttcacactgcagctttgggaaaacttcattccttgatttgtgtttgtcttggccttcctggtgtgcagtactgctgtagaaaagtattaatagcttcatttcatataaacataagtaactcccaaacacttatgtagaggactaaaaatgtatctggtatttaagtaatctgaaccagttctgcaagtgactgtgttttgtattactgtgaaaataagaaaatgtagttaattacaatttaaagagtattccacataacttcttaatttctacattccctcccttactcttcgggggtttcctttcagtaagcaacttttccatgctcttaatgtattcctttttagtaggaatccggaagtattagattgaatggaaaagcacttgccatctctgtctaggggtcacaaattgaaatggctcctgtatcacatacggaggtcttgtgtatctgtggcaacagggagtttccttattcactctttatttgctgctgtttaagttgccaacctcccctcccaataaaaattcacttacacctcctgcctttgtagttctggtattcactttactatgtgatagaagtagcatgttgctgccagaatacaagcattgcttttggcaaattaaagtgcatgtcatttcttaatacactagaaaggggaaataaattaaagtacacaagtccaagtctaaaactttagtacttttccatgcagatttgtgcacatgtgagagggtgtccagtttgtctagtgattgttatttagagagttggaccactattgtgtgttgctaatcattgactgtagtcccaaaaaagccttgtgaaaatgttatgccctatgtaacagcagagtaacataaaataaaagtacattttataaaccatttactatggctttgtaacaattgcatacccatattttaagggacaggtgaatttactactttctaaagtttattgatacttcccttttatgtaaaatgtagtagtgatacctatatttccacattgtgcattgtgacacacttgtctagggatgcctggaagtgtataaaattggactgcatttcttagagtgttttactatagatcagtctcatgggccatctcttcctcagatgtaaatgatatctggttaagtgttatatggaataaagtggacattttaaaactagcaaagttaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10971 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:10971 -> Molecular function: GO:0019904 [protein domain specific binding] evidence: IEA
GeneID:10971 -> Molecular function: GO:0047485 [protein N-terminus binding] evidence: IPI
GeneID:10971 -> Molecular function: GO:0071889 [14-3-3 protein binding] evidence: IEA
GeneID:10971 -> Biological process: GO:0006605 [protein targeting] evidence: IEA
GeneID:10971 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:10971 -> Biological process: GO:0007264 [small GTPase mediated signal transduction] evidence: IEA
GeneID:10971 -> Biological process: GO:0016044 [cellular membrane organization] evidence: TAS
GeneID:10971 -> Biological process: GO:0045892 [negative regulation of transcription, DNA-dependent] evidence: IDA
GeneID:10971 -> Biological process: GO:0097193 [intrinsic apoptotic signaling pathway] evidence: TAS
GeneID:10971 -> Biological process: GO:1900740 [positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway] evidence: TAS
GeneID:10971 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:10971 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:10971 -> Cellular component: GO:0030659 [cytoplasmic vesicle membrane] evidence: TAS
GeneID:10971 -> Cellular component: GO:0043234 [protein complex] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.