Home |
Help |
Advanced search
2024-04-19 14:04:56, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_006763 2718 bp mRNA linear PRI 26-MAY-2013
DEFINITION Homo sapiens BTG family, member 2 (BTG2), mRNA.
ACCESSION NM_006763
VERSION NM_006763.2 GI:28872718
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2718)
AUTHORS Coppola,V., Musumeci,M., Patrizii,M., Cannistraci,A., Addario,A.,
Maugeri-Sacca,M., Biffoni,M., Francescangeli,F., Cordenonsi,M.,
Piccolo,S., Memeo,L., Pagliuca,A., Muto,G., Zeuner,A., De Maria,R.
and Bonci,D.
TITLE BTG2 loss and miR-21 upregulation contribute to prostate cell
transformation by inducing luminal markers expression and
epithelial-mesenchymal transition
JOURNAL Oncogene 32 (14), 1843-1853 (2013)
PUBMED 22614007
REMARK GeneRIF: Downregulation of the basal protein B-cell translocation
gene 2 is associated with prostate cancer transformation and
progression.
REFERENCE 2 (bases 1 to 2718)
AUTHORS Wagener,N., Bulkescher,J., Macher-Goeppinger,S.,
Karapanagiotou-Schenkel,I., Hatiboglu,G., Abdel-Rahim,M.,
Abol-Enein,H., Ghoneim,M.A., Bastian,P.J., Muller,S.C.,
Haferkamp,A., Hohenfellner,M., Hoppe-Seyler,F. and Hoppe-Seyler,K.
TITLE Endogenous BTG2 expression stimulates migration of bladder cancer
cells and correlates with poor clinical prognosis for bladder
cancer patients
JOURNAL Br. J. Cancer 108 (4), 973-982 (2013)
PUBMED 23299537
REMARK GeneRIF: These results indicate that endogenous BTG2 expression
contributes to the migratory potential of bladder cancer cells.
Moreover, high levels of BTG2 in bladder cancers are linked to
decreased cancer-specific survival.
REFERENCE 3 (bases 1 to 2718)
AUTHORS Choi,K.S., Kim,J.Y., Lim,S.K., Choi,Y.W., Kim,Y.H., Kang,S.Y.,
Park,T.J. and Lim,I.K.
TITLE TIS21(/BTG2/PC3) accelerates the repair of DNA double strand breaks
by enhancing Mre11 methylation and blocking damage signal transfer
to the Chk2(T68)-p53(S20) pathway
JOURNAL DNA Repair (Amst.) 11 (12), 965-975 (2012)
PUBMED 23089312
REMARK GeneRIF: TIS21 regulates DNA double strand break repair and
apoptosis via increasing Mre11 methylation.
REFERENCE 4 (bases 1 to 2718)
AUTHORS Lim,S.K., Choi,Y.W., Lim,I.K. and Park,T.J.
TITLE BTG2 suppresses cancer cell migration through inhibition of Src-FAK
signaling by downregulation of reactive oxygen species generation
in mitochondria
JOURNAL Clin. Exp. Metastasis 29 (8), 901-913 (2012)
PUBMED 22562501
REMARK GeneRIF: study reveals that BTG2 negatively regulated cancer cell
migration by inhibiting Src activity through downregulation of
reactive oxygen species generation in mitochondria
REFERENCE 5 (bases 1 to 2718)
AUTHORS Karve,T.M. and Rosen,E.M.
TITLE B-cell translocation gene 2 (BTG2) stimulates cellular antioxidant
defenses through the antioxidant transcription factor NFE2L2 in
human mammary epithelial cells
JOURNAL J. Biol. Chem. 287 (37), 31503-31514 (2012)
PUBMED 22493435
REMARK GeneRIF: a novel role for BTG2 as a co-activator for NFE2L2 in
up-regulating cellular antioxidant defenses.
REFERENCE 6 (bases 1 to 2718)
AUTHORS Rouault,J.P., Prevot,D., Berthet,C., Birot,A.M., Billaud,M.,
Magaud,J.P. and Corbo,L.
TITLE Interaction of BTG1 and p53-regulated BTG2 gene products with
mCaf1, the murine homolog of a component of the yeast CCR4
transcriptional regulatory complex
JOURNAL J. Biol. Chem. 273 (35), 22563-22569 (1998)
PUBMED 9712883
REFERENCE 7 (bases 1 to 2718)
AUTHORS Rouault,J.P., Falette,N., Guehenneux,F., Guillot,C., Rimokh,R.,
Wang,Q., Berthet,C., Moyret-Lalle,C., Savatier,P., Pain,B.,
Shaw,P., Berger,R., Samarut,J., Magaud,J.P., Ozturk,M., Samarut,C.
and Puisieux,A.
TITLE Identification of BTG2, an antiproliferative p53-dependent
component of the DNA damage cellular response pathway
JOURNAL Nat. Genet. 14 (4), 482-486 (1996)
PUBMED 8944033
REMARK GeneRIF: First evidence that BTG2 is a target of p53 and is
activated p53-dependently by DNA damage.
REFERENCE 8 (bases 1 to 2718)
AUTHORS Montagnoli,A., Guardavaccaro,D., Starace,G. and Tirone,F.
TITLE Overexpression of the nerve growth factor-inducible PC3 immediate
early gene is associated with growth inhibition
JOURNAL Cell Growth Differ. 7 (10), 1327-1336 (1996)
PUBMED 8891336
REMARK GeneRIF: PC3 / BTG2 inhibits the proliferation of different types
of cells, including neural cells.
REFERENCE 9 (bases 1 to 2718)
AUTHORS Lin,W.J., Gary,J.D., Yang,M.C., Clarke,S. and Herschman,H.R.
TITLE The mammalian immediate-early TIS21 protein and the
leukemia-associated BTG1 protein interact with a protein-arginine
N-methyltransferase
JOURNAL J. Biol. Chem. 271 (25), 15034-15044 (1996)
PUBMED 8663146
REFERENCE 10 (bases 1 to 2718)
AUTHORS Fletcher,B.S., Lim,R.W., Varnum,B.C., Kujubu,D.A., Koski,R.A. and
Herschman,H.R.
TITLE Structure and expression of TIS21, a primary response gene induced
by growth factors and tumor promoters
JOURNAL J. Biol. Chem. 266 (22), 14511-14518 (1991)
PUBMED 1713584
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from U72649.1.
On Mar 6, 2003 this sequence version replaced gi:5802987.
Summary: The protein encoded by this gene is a member of the
BTG/Tob family. This family has structurally related proteins that
appear to have antiproliferative properties. This encoded protein
is involved in the regulation of the G1/S transition of the cell
cycle. [provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: U72649.1, BC105949.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
FEATURES Location/Qualifiers
source 1..2718
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q32"
gene 1..2718
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/note="BTG family, member 2"
/db_xref="GeneID:7832"
/db_xref="HGNC:1131"
/db_xref="HPRD:03357"
/db_xref="MIM:601597"
exon 1..213
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/inference="alignment:Splign:1.39.8"
STS 27..1456
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/db_xref="UniSTS:486854"
variation 37
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:374383359"
variation 44
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:376663776"
misc_feature 51..53
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/note="upstream in-frame stop codon"
variation 65
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:368773937"
CDS 72..548
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/note="pheochromacytoma cell-3; NGF-inducible
anti-proliferative protein PC3; nerve growth
factor-inducible anti-proliferative; B-cell translocation
gene 2"
/codon_start=1
/product="protein BTG2"
/protein_id="NP_006754.1"
/db_xref="GI:5802988"
/db_xref="CCDS:CCDS1437.1"
/db_xref="GeneID:7832"
/db_xref="HGNC:1131"
/db_xref="HPRD:03357"
/db_xref="MIM:601597"
/translation="
MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
"
misc_feature 96..446
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/note="BTG family; Region: BTG; pfam07742"
/db_xref="CDD:149033"
misc_feature 510..512
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by MAPK1 and MAPK3; propagated from
UniProtKB/Swiss-Prot (P78543.1); phosphorylation site"
misc_feature 516..518
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by MAPK14; propagated from
UniProtKB/Swiss-Prot (P78543.1); phosphorylation site"
variation 81
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:147064341"
variation 154
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:55906353"
exon 214..2712
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/inference="alignment:Splign:1.39.8"
variation 228
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/db_xref="dbSNP:375229041"
variation 239
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/db_xref="dbSNP:376703669"
variation 260
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:201232233"
variation 261
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:371754785"
variation 311
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:374866363"
variation 347
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:34095378"
variation 404
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:376775426"
variation 419
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:61749326"
variation 431
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:139728405"
variation 447
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="g"
/replace="t"
/db_xref="dbSNP:370007952"
variation 452
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="c"
/db_xref="dbSNP:144359813"
variation 458
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:142553340"
variation 466
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/db_xref="dbSNP:377682345"
variation 479
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:372912125"
variation 493
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="t"
/db_xref="dbSNP:199565298"
variation 505
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:139460533"
variation 510
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:183820479"
variation 528
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:12039961"
variation 542
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:377245155"
variation 556
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:369785815"
variation 562
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/db_xref="dbSNP:201462115"
variation 633
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:140561243"
variation 663..664
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="t"
/db_xref="dbSNP:372775786"
variation 712
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:145883516"
variation 980
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/db_xref="dbSNP:12063729"
variation 1035
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:12085417"
variation 1127
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="c"
/db_xref="dbSNP:375702332"
variation 1150
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="t"
/db_xref="dbSNP:138492634"
variation 1226..1227
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="g"
/db_xref="dbSNP:373717932"
variation 1226
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="a"
/db_xref="dbSNP:202052540"
variation 1227
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:56048832"
variation 1227
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="g"
/db_xref="dbSNP:5780160"
variation 1229
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/db_xref="dbSNP:3795582"
variation 1230..1231
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="c"
/replace="g"
/replace="gg"
/db_xref="dbSNP:373538301"
variation 1230
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/db_xref="dbSNP:114151974"
variation 1234
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:200299376"
variation 1235
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:78869403"
variation 1328
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="c"
/db_xref="dbSNP:113918784"
variation 1329
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:367900254"
variation 1428
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="t"
/db_xref="dbSNP:187962637"
variation 1530..1531
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="tt"
/db_xref="dbSNP:76519638"
variation 1552
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="g"
/replace="t"
/db_xref="dbSNP:141109235"
variation 1620
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:372059695"
variation 1713
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:191529784"
variation 1725
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:16851280"
variation 1756
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:374313138"
variation 1759
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="g"
/replace="t"
/db_xref="dbSNP:11586635"
variation 1857
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:60342861"
variation 1884
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="g"
/db_xref="dbSNP:373141560"
variation 2026
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:367892990"
variation 2040
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:150236063"
variation 2128
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="a"
/db_xref="dbSNP:369087041"
variation 2152
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:78959463"
variation 2218
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="c"
/db_xref="dbSNP:138699312"
variation 2270..2271
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="c"
/db_xref="dbSNP:34345774"
variation 2327
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:74137610"
STS 2336..2665
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/standard_name="SHGC-4213"
/db_xref="UniSTS:66189"
variation 2343..2344
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="c"
/db_xref="dbSNP:34050060"
variation 2374
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:1804736"
variation 2453
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:1804735"
variation 2457
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="c"
/db_xref="dbSNP:1804737"
variation 2466
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:76416255"
variation 2538
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:117103442"
variation 2541
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:138896134"
variation 2547
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace=""
/replace="c"
/db_xref="dbSNP:71665995"
variation 2588
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="a"
/replace="g"
/db_xref="dbSNP:1804734"
variation 2596
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/replace="c"
/replace="t"
/db_xref="dbSNP:1130691"
polyA_signal 2691..2696
/gene="BTG2"
/gene_synonym="PC3; TIS21"
polyA_site 2712
/gene="BTG2"
/gene_synonym="PC3; TIS21"
/experiment="experimental evidence, no additional details
recorded"
ORIGIN
cagggtaacgctgtcttgtggacccgcacttcccacccgagacctctcactgagcccgagccgcgcgcgacatgagccacgggaagggaaccgacatgctcccggagatcgccgccgccgtgggcttcctctccagcctcctgaggacccggggctgcgtgagcgagcagaggcttaaggtcttcagcggggcgctccaggaggcactcacagagcactacaaacaccactggtttcccgaaaagccgtccaagggctccggctaccgctgcattcgcatcaaccacaagatggaccccatcatcagcagggtggccagccagatcggactcagccagccccagctgcaccagctgctgcccagcgagctgaccctgtgggtggacccctatgaggtgtcctaccgcattggggaggacggctccatctgcgtcttgtacgaggaggccccactggccgcctcctgtgggctcctcacctgcaagaaccaagtgctgctgggccggagcagcccctccaagaactacgtgatggcagtctccagctaggcccttccgcccccgccctgggcgccgccgtgctcatgctgccgtgacaacaggccaccacatacctcaacctggggaactgtatttttaaatgaagagctatttatatatattatttttttttaagaaaggaggaaaagaaaccaaaagttttttttaagaaaaaaaatccttcaagggagctgcttggaagtggcctccccaggtgcctttggagagaactgttgcgtgcttgagtctgtgagccagtgtctgcctataggagggggagctgttagggggtagacctagccaaggagaagtgggagacgtttggctagcaccccaggaagatgtgagagggagcaagcaaggttagcaactgtgaacagagaggtcgggatttgccctgggggaggaagagaggccaagttcagagctctctgtctcccccagccagacacctgcatccctggctcctctattactcaggggcattcatgcctggacttaaacaatactatgttatcttttcttttatttttctaatgaggtcctgggcagagagtgaaaaggcctctcctgattcctactgtcctaagctgcttttcttgaaatcatgacttgtttctaattctaccctcaggggcctgtagatgttgctttccagccaggaatctaaagctttgggttttctgaggggggggaggagggaactggaggttattggggttaggatggaagggaactctgcacaaaacctttgctttgctagtgctgctttgtgtgtatgtgtggcaaataatttgggggtgatttgcaatgaaattttgggacccaaagagtatccactggggatgttttttggccaaaactcttccttttggaaccacatgaaagtcttgatgctgctgccatgatccctttgagaggtggctcaaaagctacagggaactccaggtcctttattactgccttcttttcaaaagcacaactctcctctaaccctcccctcccccttcccttctggtcgggtcatagagctaccgtattttctaggacaagagttctcagtcactgtgcaatatgccccctgggtcccaggagggtctggaggaaaactggctatcagaacctcctgatgccctggtgggcttagggaaccatctctcctgctctccttgggatgatggctggctagtcagccttgcatgtattccttggctgaatgggagagtgccccatgttctgcaagactacttggtattcttgtagggccgacactaaataaaagccaaaccttgggcactgttttttctccctggtgctcagagcacctgtgggaaaggttgctgtctgtctcagtacaatccaaatttgtcgtagacttgtgcaatatatactgttgtgggttggagaaaagtggaaagctacactgggaagaaactcccttccttcaatttctcagtgacattgatgaggggtcctcaaaagacctcgagtttcccaaaccgaatcaccttaagaaggacagggctagggcatttggccaggatggccaccctcctgctgttgccccttagtgaggaatcttcaccccacttcctctacccccaggttctcctccccacagccagtcccctttcctggatttctaaactgctcaattttgactcaaaggtgctatttaccaaacactctccctacccattcctgccagctctgcctccttttcaactctccacattttgtattgccttcccagacctgcttccagtctttattgctttaaagttcactttgggcccacagacccaagagctaattttctggtttgtgggttgaaacaaagctgtgaatcactgcaggctgtgttcttgcatcttgtctgcaaacaggtccctgcctttttagaagcagcctcatggtctcatgcttaatcttgtctctcttctcttctttatgatgttcactttaaaaacaacaaaacccctgagctggactgttgagcaggcctgtctctcctattaagtaaaaataaatagtagtagtatgtttgtaagctattctgacagaaaagacaaaggttactaattgtatgatagtgtttttatatggaagaatgtacagcttatggacaaatgtacacctttttgttactttaataaaaatgtagtaggataaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:7832 -> Molecular function: GO:0001077 [RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription] evidence: IEA
GeneID:7832 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:7832 -> Biological process: GO:0006281 [DNA repair] evidence: TAS
GeneID:7832 -> Biological process: GO:0006479 [protein methylation] evidence: IEA
GeneID:7832 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IDA
GeneID:7832 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IMP
GeneID:7832 -> Biological process: GO:0008306 [associative learning] evidence: IEA
GeneID:7832 -> Biological process: GO:0009612 [response to mechanical stimulus] evidence: IEA
GeneID:7832 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: IEA
GeneID:7832 -> Biological process: GO:0014070 [response to organic cyclic compound] evidence: IEA
GeneID:7832 -> Biological process: GO:0017148 [negative regulation of translation] evidence: IDA
GeneID:7832 -> Biological process: GO:0021542 [dentate gyrus development] evidence: IEA
GeneID:7832 -> Biological process: GO:0021954 [central nervous system neuron development] evidence: IEA
GeneID:7832 -> Biological process: GO:0031175 [neuron projection development] evidence: IMP
GeneID:7832 -> Biological process: GO:0035914 [skeletal muscle cell differentiation] evidence: IEA
GeneID:7832 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA
GeneID:7832 -> Biological process: GO:0043434 [response to peptide hormone stimulus] evidence: IEA
GeneID:7832 -> Biological process: GO:0051602 [response to electrical stimulus] evidence: IEA
GeneID:7832 -> Biological process: GO:0060213 [positive regulation of nuclear-transcribed mRNA poly(A) tail shortening] evidence: IDA
GeneID:7832 -> Biological process: GO:2000178 [negative regulation of neural precursor cell proliferation] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.