2024-04-26 07:41:59, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_006763 2718 bp mRNA linear PRI 26-MAY-2013 DEFINITION Homo sapiens BTG family, member 2 (BTG2), mRNA. ACCESSION NM_006763 VERSION NM_006763.2 GI:28872718 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2718) AUTHORS Coppola,V., Musumeci,M., Patrizii,M., Cannistraci,A., Addario,A., Maugeri-Sacca,M., Biffoni,M., Francescangeli,F., Cordenonsi,M., Piccolo,S., Memeo,L., Pagliuca,A., Muto,G., Zeuner,A., De Maria,R. and Bonci,D. TITLE BTG2 loss and miR-21 upregulation contribute to prostate cell transformation by inducing luminal markers expression and epithelial-mesenchymal transition JOURNAL Oncogene 32 (14), 1843-1853 (2013) PUBMED 22614007 REMARK GeneRIF: Downregulation of the basal protein B-cell translocation gene 2 is associated with prostate cancer transformation and progression. REFERENCE 2 (bases 1 to 2718) AUTHORS Wagener,N., Bulkescher,J., Macher-Goeppinger,S., Karapanagiotou-Schenkel,I., Hatiboglu,G., Abdel-Rahim,M., Abol-Enein,H., Ghoneim,M.A., Bastian,P.J., Muller,S.C., Haferkamp,A., Hohenfellner,M., Hoppe-Seyler,F. and Hoppe-Seyler,K. TITLE Endogenous BTG2 expression stimulates migration of bladder cancer cells and correlates with poor clinical prognosis for bladder cancer patients JOURNAL Br. J. Cancer 108 (4), 973-982 (2013) PUBMED 23299537 REMARK GeneRIF: These results indicate that endogenous BTG2 expression contributes to the migratory potential of bladder cancer cells. Moreover, high levels of BTG2 in bladder cancers are linked to decreased cancer-specific survival. REFERENCE 3 (bases 1 to 2718) AUTHORS Choi,K.S., Kim,J.Y., Lim,S.K., Choi,Y.W., Kim,Y.H., Kang,S.Y., Park,T.J. and Lim,I.K. TITLE TIS21(/BTG2/PC3) accelerates the repair of DNA double strand breaks by enhancing Mre11 methylation and blocking damage signal transfer to the Chk2(T68)-p53(S20) pathway JOURNAL DNA Repair (Amst.) 11 (12), 965-975 (2012) PUBMED 23089312 REMARK GeneRIF: TIS21 regulates DNA double strand break repair and apoptosis via increasing Mre11 methylation. REFERENCE 4 (bases 1 to 2718) AUTHORS Lim,S.K., Choi,Y.W., Lim,I.K. and Park,T.J. TITLE BTG2 suppresses cancer cell migration through inhibition of Src-FAK signaling by downregulation of reactive oxygen species generation in mitochondria JOURNAL Clin. Exp. Metastasis 29 (8), 901-913 (2012) PUBMED 22562501 REMARK GeneRIF: study reveals that BTG2 negatively regulated cancer cell migration by inhibiting Src activity through downregulation of reactive oxygen species generation in mitochondria REFERENCE 5 (bases 1 to 2718) AUTHORS Karve,T.M. and Rosen,E.M. TITLE B-cell translocation gene 2 (BTG2) stimulates cellular antioxidant defenses through the antioxidant transcription factor NFE2L2 in human mammary epithelial cells JOURNAL J. Biol. Chem. 287 (37), 31503-31514 (2012) PUBMED 22493435 REMARK GeneRIF: a novel role for BTG2 as a co-activator for NFE2L2 in up-regulating cellular antioxidant defenses. REFERENCE 6 (bases 1 to 2718) AUTHORS Rouault,J.P., Prevot,D., Berthet,C., Birot,A.M., Billaud,M., Magaud,J.P. and Corbo,L. TITLE Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex JOURNAL J. Biol. Chem. 273 (35), 22563-22569 (1998) PUBMED 9712883 REFERENCE 7 (bases 1 to 2718) AUTHORS Rouault,J.P., Falette,N., Guehenneux,F., Guillot,C., Rimokh,R., Wang,Q., Berthet,C., Moyret-Lalle,C., Savatier,P., Pain,B., Shaw,P., Berger,R., Samarut,J., Magaud,J.P., Ozturk,M., Samarut,C. and Puisieux,A. TITLE Identification of BTG2, an antiproliferative p53-dependent component of the DNA damage cellular response pathway JOURNAL Nat. Genet. 14 (4), 482-486 (1996) PUBMED 8944033 REMARK GeneRIF: First evidence that BTG2 is a target of p53 and is activated p53-dependently by DNA damage. REFERENCE 8 (bases 1 to 2718) AUTHORS Montagnoli,A., Guardavaccaro,D., Starace,G. and Tirone,F. TITLE Overexpression of the nerve growth factor-inducible PC3 immediate early gene is associated with growth inhibition JOURNAL Cell Growth Differ. 7 (10), 1327-1336 (1996) PUBMED 8891336 REMARK GeneRIF: PC3 / BTG2 inhibits the proliferation of different types of cells, including neural cells. REFERENCE 9 (bases 1 to 2718) AUTHORS Lin,W.J., Gary,J.D., Yang,M.C., Clarke,S. and Herschman,H.R. TITLE The mammalian immediate-early TIS21 protein and the leukemia-associated BTG1 protein interact with a protein-arginine N-methyltransferase JOURNAL J. Biol. Chem. 271 (25), 15034-15044 (1996) PUBMED 8663146 REFERENCE 10 (bases 1 to 2718) AUTHORS Fletcher,B.S., Lim,R.W., Varnum,B.C., Kujubu,D.A., Koski,R.A. and Herschman,H.R. TITLE Structure and expression of TIS21, a primary response gene induced by growth factors and tumor promoters JOURNAL J. Biol. Chem. 266 (22), 14511-14518 (1991) PUBMED 1713584 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from U72649.1. On Mar 6, 2003 this sequence version replaced gi:5802987. Summary: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: U72649.1, BC105949.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..2718 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="1" /map="1q32" gene 1..2718 /gene="BTG2" /gene_synonym="PC3; TIS21" /note="BTG family, member 2" /db_xref="GeneID:7832" /db_xref="HGNC:1131" /db_xref="HPRD:03357" /db_xref="MIM:601597" exon 1..213 /gene="BTG2" /gene_synonym="PC3; TIS21" /inference="alignment:Splign:1.39.8" STS 27..1456 /gene="BTG2" /gene_synonym="PC3; TIS21" /db_xref="UniSTS:486854" variation 37 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:374383359" variation 44 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:376663776" misc_feature 51..53 /gene="BTG2" /gene_synonym="PC3; TIS21" /note="upstream in-frame stop codon" variation 65 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:368773937" CDS 72..548 /gene="BTG2" /gene_synonym="PC3; TIS21" /note="pheochromacytoma cell-3; NGF-inducible anti-proliferative protein PC3; nerve growth factor-inducible anti-proliferative; B-cell translocation gene 2" /codon_start=1 /product="protein BTG2" /protein_id="NP_006754.1" /db_xref="GI:5802988" /db_xref="CCDS:CCDS1437.1" /db_xref="GeneID:7832" /db_xref="HGNC:1131" /db_xref="HPRD:03357" /db_xref="MIM:601597" /translation="
MSHGKGTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSGALQEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
" misc_feature 96..446 /gene="BTG2" /gene_synonym="PC3; TIS21" /note="BTG family; Region: BTG; pfam07742" /db_xref="CDD:149033" misc_feature 510..512 /gene="BTG2" /gene_synonym="PC3; TIS21" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by MAPK1 and MAPK3; propagated from UniProtKB/Swiss-Prot (P78543.1); phosphorylation site" misc_feature 516..518 /gene="BTG2" /gene_synonym="PC3; TIS21" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by MAPK14; propagated from UniProtKB/Swiss-Prot (P78543.1); phosphorylation site" variation 81 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:147064341" variation 154 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:55906353" exon 214..2712 /gene="BTG2" /gene_synonym="PC3; TIS21" /inference="alignment:Splign:1.39.8" variation 228 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /db_xref="dbSNP:375229041" variation 239 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /db_xref="dbSNP:376703669" variation 260 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:201232233" variation 261 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:371754785" variation 311 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:374866363" variation 347 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:34095378" variation 404 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:376775426" variation 419 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:61749326" variation 431 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:139728405" variation 447 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="g" /replace="t" /db_xref="dbSNP:370007952" variation 452 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="c" /db_xref="dbSNP:144359813" variation 458 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:142553340" variation 466 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /db_xref="dbSNP:377682345" variation 479 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:372912125" variation 493 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="t" /db_xref="dbSNP:199565298" variation 505 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:139460533" variation 510 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:183820479" variation 528 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:12039961" variation 542 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:377245155" variation 556 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:369785815" variation 562 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /db_xref="dbSNP:201462115" variation 633 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:140561243" variation 663..664 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="t" /db_xref="dbSNP:372775786" variation 712 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:145883516" variation 980 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /db_xref="dbSNP:12063729" variation 1035 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:12085417" variation 1127 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="c" /db_xref="dbSNP:375702332" variation 1150 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="t" /db_xref="dbSNP:138492634" variation 1226..1227 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="g" /db_xref="dbSNP:373717932" variation 1226 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="a" /db_xref="dbSNP:202052540" variation 1227 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:56048832" variation 1227 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="g" /db_xref="dbSNP:5780160" variation 1229 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /db_xref="dbSNP:3795582" variation 1230..1231 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="c" /replace="g" /replace="gg" /db_xref="dbSNP:373538301" variation 1230 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /db_xref="dbSNP:114151974" variation 1234 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:200299376" variation 1235 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:78869403" variation 1328 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="c" /db_xref="dbSNP:113918784" variation 1329 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:367900254" variation 1428 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="t" /db_xref="dbSNP:187962637" variation 1530..1531 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="tt" /db_xref="dbSNP:76519638" variation 1552 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="g" /replace="t" /db_xref="dbSNP:141109235" variation 1620 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:372059695" variation 1713 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:191529784" variation 1725 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:16851280" variation 1756 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:374313138" variation 1759 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="g" /replace="t" /db_xref="dbSNP:11586635" variation 1857 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:60342861" variation 1884 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="g" /db_xref="dbSNP:373141560" variation 2026 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:367892990" variation 2040 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:150236063" variation 2128 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="a" /db_xref="dbSNP:369087041" variation 2152 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:78959463" variation 2218 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="c" /db_xref="dbSNP:138699312" variation 2270..2271 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="c" /db_xref="dbSNP:34345774" variation 2327 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:74137610" STS 2336..2665 /gene="BTG2" /gene_synonym="PC3; TIS21" /standard_name="SHGC-4213" /db_xref="UniSTS:66189" variation 2343..2344 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="c" /db_xref="dbSNP:34050060" variation 2374 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:1804736" variation 2453 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:1804735" variation 2457 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="c" /db_xref="dbSNP:1804737" variation 2466 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:76416255" variation 2538 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:117103442" variation 2541 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:138896134" variation 2547 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="" /replace="c" /db_xref="dbSNP:71665995" variation 2588 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="a" /replace="g" /db_xref="dbSNP:1804734" variation 2596 /gene="BTG2" /gene_synonym="PC3; TIS21" /replace="c" /replace="t" /db_xref="dbSNP:1130691" polyA_signal 2691..2696 /gene="BTG2" /gene_synonym="PC3; TIS21" polyA_site 2712 /gene="BTG2" /gene_synonym="PC3; TIS21" /experiment="experimental evidence, no additional details recorded" ORIGIN
cagggtaacgctgtcttgtggacccgcacttcccacccgagacctctcactgagcccgagccgcgcgcgacatgagccacgggaagggaaccgacatgctcccggagatcgccgccgccgtgggcttcctctccagcctcctgaggacccggggctgcgtgagcgagcagaggcttaaggtcttcagcggggcgctccaggaggcactcacagagcactacaaacaccactggtttcccgaaaagccgtccaagggctccggctaccgctgcattcgcatcaaccacaagatggaccccatcatcagcagggtggccagccagatcggactcagccagccccagctgcaccagctgctgcccagcgagctgaccctgtgggtggacccctatgaggtgtcctaccgcattggggaggacggctccatctgcgtcttgtacgaggaggccccactggccgcctcctgtgggctcctcacctgcaagaaccaagtgctgctgggccggagcagcccctccaagaactacgtgatggcagtctccagctaggcccttccgcccccgccctgggcgccgccgtgctcatgctgccgtgacaacaggccaccacatacctcaacctggggaactgtatttttaaatgaagagctatttatatatattatttttttttaagaaaggaggaaaagaaaccaaaagttttttttaagaaaaaaaatccttcaagggagctgcttggaagtggcctccccaggtgcctttggagagaactgttgcgtgcttgagtctgtgagccagtgtctgcctataggagggggagctgttagggggtagacctagccaaggagaagtgggagacgtttggctagcaccccaggaagatgtgagagggagcaagcaaggttagcaactgtgaacagagaggtcgggatttgccctgggggaggaagagaggccaagttcagagctctctgtctcccccagccagacacctgcatccctggctcctctattactcaggggcattcatgcctggacttaaacaatactatgttatcttttcttttatttttctaatgaggtcctgggcagagagtgaaaaggcctctcctgattcctactgtcctaagctgcttttcttgaaatcatgacttgtttctaattctaccctcaggggcctgtagatgttgctttccagccaggaatctaaagctttgggttttctgaggggggggaggagggaactggaggttattggggttaggatggaagggaactctgcacaaaacctttgctttgctagtgctgctttgtgtgtatgtgtggcaaataatttgggggtgatttgcaatgaaattttgggacccaaagagtatccactggggatgttttttggccaaaactcttccttttggaaccacatgaaagtcttgatgctgctgccatgatccctttgagaggtggctcaaaagctacagggaactccaggtcctttattactgccttcttttcaaaagcacaactctcctctaaccctcccctcccccttcccttctggtcgggtcatagagctaccgtattttctaggacaagagttctcagtcactgtgcaatatgccccctgggtcccaggagggtctggaggaaaactggctatcagaacctcctgatgccctggtgggcttagggaaccatctctcctgctctccttgggatgatggctggctagtcagccttgcatgtattccttggctgaatgggagagtgccccatgttctgcaagactacttggtattcttgtagggccgacactaaataaaagccaaaccttgggcactgttttttctccctggtgctcagagcacctgtgggaaaggttgctgtctgtctcagtacaatccaaatttgtcgtagacttgtgcaatatatactgttgtgggttggagaaaagtggaaagctacactgggaagaaactcccttccttcaatttctcagtgacattgatgaggggtcctcaaaagacctcgagtttcccaaaccgaatcaccttaagaaggacagggctagggcatttggccaggatggccaccctcctgctgttgccccttagtgaggaatcttcaccccacttcctctacccccaggttctcctccccacagccagtcccctttcctggatttctaaactgctcaattttgactcaaaggtgctatttaccaaacactctccctacccattcctgccagctctgcctccttttcaactctccacattttgtattgccttcccagacctgcttccagtctttattgctttaaagttcactttgggcccacagacccaagagctaattttctggtttgtgggttgaaacaaagctgtgaatcactgcaggctgtgttcttgcatcttgtctgcaaacaggtccctgcctttttagaagcagcctcatggtctcatgcttaatcttgtctctcttctcttctttatgatgttcactttaaaaacaacaaaacccctgagctggactgttgagcaggcctgtctctcctattaagtaaaaataaatagtagtagtatgtttgtaagctattctgacagaaaagacaaaggttactaattgtatgatagtgtttttatatggaagaatgtacagcttatggacaaatgtacacctttttgttactttaataaaaatgtagtaggataaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:7832 -> Molecular function: GO:0001077 [RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription] evidence: IEA GeneID:7832 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:7832 -> Biological process: GO:0006281 [DNA repair] evidence: TAS GeneID:7832 -> Biological process: GO:0006479 [protein methylation] evidence: IEA GeneID:7832 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IDA GeneID:7832 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IMP GeneID:7832 -> Biological process: GO:0008306 [associative learning] evidence: IEA GeneID:7832 -> Biological process: GO:0009612 [response to mechanical stimulus] evidence: IEA GeneID:7832 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: IEA GeneID:7832 -> Biological process: GO:0014070 [response to organic cyclic compound] evidence: IEA GeneID:7832 -> Biological process: GO:0017148 [negative regulation of translation] evidence: IDA GeneID:7832 -> Biological process: GO:0021542 [dentate gyrus development] evidence: IEA GeneID:7832 -> Biological process: GO:0021954 [central nervous system neuron development] evidence: IEA GeneID:7832 -> Biological process: GO:0031175 [neuron projection development] evidence: IMP GeneID:7832 -> Biological process: GO:0035914 [skeletal muscle cell differentiation] evidence: IEA GeneID:7832 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA GeneID:7832 -> Biological process: GO:0043434 [response to peptide hormone stimulus] evidence: IEA GeneID:7832 -> Biological process: GO:0051602 [response to electrical stimulus] evidence: IEA GeneID:7832 -> Biological process: GO:0060213 [positive regulation of nuclear-transcribed mRNA poly(A) tail shortening] evidence: IDA GeneID:7832 -> Biological process: GO:2000178 [negative regulation of neural precursor cell proliferation] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.