2024-03-29 15:39:33, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_006705 1087 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens growth arrest and DNA-damage-inducible, gamma (GADD45G), mRNA. ACCESSION NM_006705 VERSION NM_006705.3 GI:209413759 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1087) AUTHORS Shin,G.T., Lee,H.J. and Kim,H. TITLE GADD45gamma regulates TNF-alpha and IL-6 synthesis in THP-1 cells JOURNAL Inflamm. Res. 61 (11), 1195-1202 (2012) PUBMED 22752116 REMARK GeneRIF: Knock-down of GADD45gamma significantly attenuates TNF-a and IL-6 production in the human monocyte-macrophage THP-1 cell line as well as in human peripheral blood mononuclear cells REFERENCE 2 (bases 1 to 1087) AUTHORS Mezzomo,L.C., Gonzales,P.H., Pesce,F.G., Kretzmann Filho,N., Ferreira,N.P., Oliveira,M.C. and Kohek,M.B. TITLE Expression of cell growth negative regulators MEG3 and GADD45gamma is lost in most sporadic human pituitary adenomas JOURNAL Pituitary 15 (3), 420-427 (2012) PUBMED 21850407 REMARK GeneRIF: clinically non-functioning adenomas had a significant decrease (P<0.001) in the relative levels of GADD45c expression (13 of 14 adenomas or 92%), compared to functioning adenomas (11 of 24 or 46%) REFERENCE 3 (bases 1 to 1087) AUTHORS Zhang,W., Fu,S., Liu,X., Zhao,X., Zhang,W., Peng,W., Wu,C., Li,Y., Li,X., Bartlam,M., Zeng,Z.H., Zhan,Q. and Rao,Z. TITLE Crystal structure of human Gadd45gamma [corrected] reveals an active dimer JOURNAL Protein Cell 2 (10), 814-826 (2011) PUBMED 22058036 REMARK GeneRIF: These results reveal the mechanism of self-association by Gadd45 proteins and the importance of this self-association for their biological function Erratum:[Protein Cell. 2012 Mar;3(3):239] REFERENCE 4 (bases 1 to 1087) AUTHORS Zerbini,L.F., Tamura,R.E., Correa,R.G., Czibere,A., Cordeiro,J., Bhasin,M., Simabuco,F.M., Wang,Y., Gu,X., Li,L., Sarkar,D., Zhou,J.R., Fisher,P.B. and Libermann,T.A. TITLE Combinatorial effect of non-steroidal anti-inflammatory drugs and NF-kappaB inhibitors in ovarian cancer therapy JOURNAL PLoS ONE 6 (9), E24285 (2011) PUBMED 21931671 REMARK GeneRIF: Data show that mda-7/IL-24 activation leads to upregulation of growth arrest and DNA damage inducible (GADD) 45 alpha and gamma and JNK activation. REFERENCE 5 (bases 1 to 1087) AUTHORS Flores,O. and Burnstein,K.L. TITLE GADD45gamma: a new vitamin D-regulated gene that is antiproliferative in prostate cancer cells JOURNAL Endocrinology 151 (10), 4654-4664 (2010) PUBMED 20739400 REMARK GeneRIF: The induction of GADD45gamma gene expression by 1,25-(OH)2D3 may mark therapeutic response in prostate cancer. REFERENCE 6 (bases 1 to 1087) AUTHORS Zhang,W., Bae,I., Krishnaraju,K., Azam,N., Fan,W., Smith,K., Hoffman,B. and Liebermann,D.A. TITLE CR6: A third member in the MyD118 and Gadd45 gene family which functions in negative growth control JOURNAL Oncogene 18 (35), 4899-4907 (1999) PUBMED 10490824 REFERENCE 7 (bases 1 to 1087) AUTHORS Nakayama,K., Hara,T., Hibi,M., Hirano,T. and Miyajima,A. TITLE A novel oncostatin M-inducible gene OIG37 forms a gene family with MyD118 and GADD45 and negatively regulates cell growth JOURNAL J. Biol. Chem. 274 (35), 24766-24772 (1999) PUBMED 10455148 REFERENCE 8 (bases 1 to 1087) AUTHORS Suzuki,M., Watanabe,T.K., Fujiwara,T., Nakamura,Yp.6., Takahashi,E. and Tanigami,A. TITLE Molecular cloning, expression, and mapping of a novel human cDNA, GRP17, highly homologous to human gadd45 and murine MyD118 JOURNAL J. Hum. Genet. 44 (5), 300-303 (1999) PUBMED 10496071 REFERENCE 9 (bases 1 to 1087) AUTHORS Takekawa,M. and Saito,H. TITLE A family of stress-inducible GADD45-like proteins mediate activation of the stress-responsive MTK1/MEKK4 MAPKKK JOURNAL Cell 95 (4), 521-530 (1998) PUBMED 9827804 REFERENCE 10 (bases 1 to 1087) AUTHORS Beadling,C., Johnson,K.W. and Smith,K.A. TITLE Isolation of interleukin 2-induced immediate-early genes JOURNAL Proc. Natl. Acad. Sci. U.S.A. 90 (7), 2719-2723 (1993) PUBMED 7681987 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DA420966.1 and BC019325.1. On Oct 11, 2008 this sequence version replaced gi:9790905. Summary: This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC000465.2, D83023.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-553 DA420966.1 1-553 554-1087 BC019325.1 535-1068 FEATURES Location/Qualifiers source 1..1087 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="9" /map="9q22.1-q22.2" gene 1..1087 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /note="growth arrest and DNA-damage-inducible, gamma" /db_xref="GeneID:10912" /db_xref="HGNC:4097" /db_xref="HPRD:05383" /db_xref="MIM:604949" exon 1..163 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /inference="alignment:Splign:1.39.8" variation 19 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="c" /replace="t" /db_xref="dbSNP:3138500" variation 69 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="c" /db_xref="dbSNP:372539162" variation 74 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="c" /replace="t" /db_xref="dbSNP:184267279" misc_feature 90..92 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /note="upstream in-frame stop codon" variation 105 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="c" /db_xref="dbSNP:374588217" variation 110 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="t" /db_xref="dbSNP:141169302" CDS 111..590 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /note="GADD45-gamma; gadd-related protein, 17 kD; DDIT-2; cytokine-responsive protein CR6; DNA damage-inducible transcript 2 protein" /codon_start=1 /product="growth arrest and DNA damage-inducible protein GADD45 gamma" /protein_id="NP_006696.1" /db_xref="GI:5729836" /db_xref="CCDS:CCDS6686.1" /db_xref="GeneID:10912" /db_xref="HGNC:4097" /db_xref="HPRD:05383" /db_xref="MIM:604949" /translation="
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
" misc_feature 180..>413 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /note="Ribosomal protein L7Ae/L30e/S12e/Gadd45 family; Region: Ribosomal_L7Ae; pfam01248" /db_xref="CDD:201684" variation 139 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:199566315" variation 149 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:377489263" variation 159 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="g" /replace="t" /db_xref="dbSNP:371764432" exon 164..265 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /inference="alignment:Splign:1.39.8" variation 182 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:371625737" variation 236 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="c" /replace="t" /db_xref="dbSNP:375895752" exon 266..479 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /inference="alignment:Splign:1.39.8" variation 317 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:144997883" variation 335 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:144229332" variation 406 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:375451298" variation 428 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="c" /db_xref="dbSNP:138848476" variation 438 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:71512212" variation 444 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:3138505" exon 480..1066 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /inference="alignment:Splign:1.39.8" variation 487 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:376168420" variation 488 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="c" /db_xref="dbSNP:34954994" variation 553 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="g" /replace="t" /db_xref="dbSNP:144775138" variation 566 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:148149951" variation 600 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:5031028" variation 606 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:8252" variation 615 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="c" /db_xref="dbSNP:376998051" variation 684 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="c" /replace="g" /db_xref="dbSNP:201824646" variation 710 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="" /replace="g" /db_xref="dbSNP:5031029" variation 710 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="g" /replace="t" /db_xref="dbSNP:112620591" variation 711 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:370717452" variation 748 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="c" /db_xref="dbSNP:17055047" variation 798 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="c" /replace="t" /db_xref="dbSNP:56370514" variation 855 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="c" /db_xref="dbSNP:3138506" variation 927 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="c" /replace="t" /db_xref="dbSNP:189468471" variation 985 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" /replace="a" /replace="g" /db_xref="dbSNP:180716901" polyA_signal 1047..1052 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" polyA_site 1066 /gene="GADD45G" /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17" ORIGIN
gcactcgctggtggtgggcgcgccgtgctgagctctggctgtcagtgtgttcgcccgcgtcccctccgcgctctccgcttgtggataactagctgctggttgatcgcactatgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcagggtgccgggaaagcgctgcatgagttgctgctgtcggcgcagcgtcagggctgcctcactgccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgtgtgctggctgcgggtgaggaggacgagggcgacatcgcgctgcagatccattttacgctgatccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcggctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatcctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctgttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtgacagcccggcggggaccttggtctgatcgacgtggtgacgccccggggcgcctagagcgcggctggctctgtggaggggccctccgagggtgcccgagtgcggcgtggagactggcaggcggggggggcgcctggagagcgaggaggcgcggcctcccgaggaggggcccggtggcggcagggccaggctggtccgagctgaggactctgcaagtgtctggagcggctgctcgcccaggaaggcctaggctaggacgttggcctcagggccaggaaggacagactggccgggcaggcgtgactcagcagcctgcgctcggcaggaaggagcggcgccctggacttggtacagttgcaggagcgtgaaggacttagccgactgcgctgctttttcaaaacggatccgggcaatgcttcgttttctaaaggatgctgctgttgaagctttgaattttacaataaactttttgaaacaaaaaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:10912 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:10912 -> Biological process: GO:0000185 [activation of MAPKKK activity] evidence: TAS GeneID:10912 -> Biological process: GO:0000186 [activation of MAPKK activity] evidence: IEA GeneID:10912 -> Biological process: GO:0006281 [DNA repair] evidence: TAS GeneID:10912 -> Biological process: GO:0006469 [negative regulation of protein kinase activity] evidence: IEA GeneID:10912 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:10912 -> Biological process: GO:0006950 [response to stress] evidence: TAS GeneID:10912 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA GeneID:10912 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA GeneID:10912 -> Biological process: GO:0051726 [regulation of cell cycle] evidence: IEA GeneID:10912 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.