GGRNA Home | Help | Advanced search

2024-03-29 15:39:33, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_006705               1087 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens growth arrest and DNA-damage-inducible, gamma
            (GADD45G), mRNA.
ACCESSION   NM_006705
VERSION     NM_006705.3  GI:209413759
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1087)
  AUTHORS   Shin,G.T., Lee,H.J. and Kim,H.
  TITLE     GADD45gamma regulates TNF-alpha and IL-6 synthesis in THP-1 cells
  JOURNAL   Inflamm. Res. 61 (11), 1195-1202 (2012)
   PUBMED   22752116
  REMARK    GeneRIF: Knock-down of GADD45gamma significantly attenuates TNF-a
            and IL-6 production in the human monocyte-macrophage THP-1 cell
            line as well as in human peripheral blood mononuclear cells
REFERENCE   2  (bases 1 to 1087)
  AUTHORS   Mezzomo,L.C., Gonzales,P.H., Pesce,F.G., Kretzmann Filho,N.,
            Ferreira,N.P., Oliveira,M.C. and Kohek,M.B.
  TITLE     Expression of cell growth negative regulators MEG3 and GADD45gamma
            is lost in most sporadic human pituitary adenomas
  JOURNAL   Pituitary 15 (3), 420-427 (2012)
   PUBMED   21850407
  REMARK    GeneRIF: clinically non-functioning adenomas had a significant
            decrease (P<0.001) in the relative levels of GADD45c expression (13
            of 14 adenomas or 92%), compared to functioning adenomas (11 of 24
            or 46%)
REFERENCE   3  (bases 1 to 1087)
  AUTHORS   Zhang,W., Fu,S., Liu,X., Zhao,X., Zhang,W., Peng,W., Wu,C., Li,Y.,
            Li,X., Bartlam,M., Zeng,Z.H., Zhan,Q. and Rao,Z.
  TITLE     Crystal structure of human Gadd45gamma [corrected] reveals an
            active dimer
  JOURNAL   Protein Cell 2 (10), 814-826 (2011)
   PUBMED   22058036
  REMARK    GeneRIF: These results reveal the mechanism of self-association by
            Gadd45 proteins and the importance of this self-association for
            their biological function
            Erratum:[Protein Cell. 2012 Mar;3(3):239]
REFERENCE   4  (bases 1 to 1087)
  AUTHORS   Zerbini,L.F., Tamura,R.E., Correa,R.G., Czibere,A., Cordeiro,J.,
            Bhasin,M., Simabuco,F.M., Wang,Y., Gu,X., Li,L., Sarkar,D.,
            Zhou,J.R., Fisher,P.B. and Libermann,T.A.
  TITLE     Combinatorial effect of non-steroidal anti-inflammatory drugs and
            NF-kappaB inhibitors in ovarian cancer therapy
  JOURNAL   PLoS ONE 6 (9), E24285 (2011)
   PUBMED   21931671
  REMARK    GeneRIF: Data show that mda-7/IL-24 activation leads to
            upregulation of growth arrest and DNA damage inducible (GADD) 45
            alpha and gamma and JNK activation.
REFERENCE   5  (bases 1 to 1087)
  AUTHORS   Flores,O. and Burnstein,K.L.
  TITLE     GADD45gamma: a new vitamin D-regulated gene that is
            antiproliferative in prostate cancer cells
  JOURNAL   Endocrinology 151 (10), 4654-4664 (2010)
   PUBMED   20739400
  REMARK    GeneRIF: The induction of GADD45gamma gene expression by
            1,25-(OH)2D3 may mark therapeutic response in prostate cancer.
REFERENCE   6  (bases 1 to 1087)
  AUTHORS   Zhang,W., Bae,I., Krishnaraju,K., Azam,N., Fan,W., Smith,K.,
            Hoffman,B. and Liebermann,D.A.
  TITLE     CR6: A third member in the MyD118 and Gadd45 gene family which
            functions in negative growth control
  JOURNAL   Oncogene 18 (35), 4899-4907 (1999)
   PUBMED   10490824
REFERENCE   7  (bases 1 to 1087)
  AUTHORS   Nakayama,K., Hara,T., Hibi,M., Hirano,T. and Miyajima,A.
  TITLE     A novel oncostatin M-inducible gene OIG37 forms a gene family with
            MyD118 and GADD45 and negatively regulates cell growth
  JOURNAL   J. Biol. Chem. 274 (35), 24766-24772 (1999)
   PUBMED   10455148
REFERENCE   8  (bases 1 to 1087)
  AUTHORS   Suzuki,M., Watanabe,T.K., Fujiwara,T., Nakamura,Yp.6., Takahashi,E.
            and Tanigami,A.
  TITLE     Molecular cloning, expression, and mapping of a novel human cDNA,
            GRP17, highly homologous to human gadd45 and murine MyD118
  JOURNAL   J. Hum. Genet. 44 (5), 300-303 (1999)
   PUBMED   10496071
REFERENCE   9  (bases 1 to 1087)
  AUTHORS   Takekawa,M. and Saito,H.
  TITLE     A family of stress-inducible GADD45-like proteins mediate
            activation of the stress-responsive MTK1/MEKK4 MAPKKK
  JOURNAL   Cell 95 (4), 521-530 (1998)
   PUBMED   9827804
REFERENCE   10 (bases 1 to 1087)
  AUTHORS   Beadling,C., Johnson,K.W. and Smith,K.A.
  TITLE     Isolation of interleukin 2-induced immediate-early genes
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 90 (7), 2719-2723 (1993)
   PUBMED   7681987
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA420966.1 and BC019325.1.
            On Oct 11, 2008 this sequence version replaced gi:9790905.
            
            Summary: This gene is a member of a group of genes whose transcript
            levels are increased following stressful growth arrest conditions
            and treatment with DNA-damaging agents. The protein encoded by this
            gene responds to environmental stresses by mediating activation of
            the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly
            expressed in placenta. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC000465.2, D83023.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025081, ERS025082 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-553               DA420966.1         1-553
            554-1087            BC019325.1         535-1068
FEATURES             Location/Qualifiers
     source          1..1087
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="9"
                     /map="9q22.1-q22.2"
     gene            1..1087
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /note="growth arrest and DNA-damage-inducible, gamma"
                     /db_xref="GeneID:10912"
                     /db_xref="HGNC:4097"
                     /db_xref="HPRD:05383"
                     /db_xref="MIM:604949"
     exon            1..163
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /inference="alignment:Splign:1.39.8"
     variation       19
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3138500"
     variation       69
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372539162"
     variation       74
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184267279"
     misc_feature    90..92
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /note="upstream in-frame stop codon"
     variation       105
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374588217"
     variation       110
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:141169302"
     CDS             111..590
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /note="GADD45-gamma; gadd-related protein, 17 kD; DDIT-2;
                     cytokine-responsive protein CR6; DNA damage-inducible
                     transcript 2 protein"
                     /codon_start=1
                     /product="growth arrest and DNA damage-inducible protein
                     GADD45 gamma"
                     /protein_id="NP_006696.1"
                     /db_xref="GI:5729836"
                     /db_xref="CCDS:CCDS6686.1"
                     /db_xref="GeneID:10912"
                     /db_xref="HGNC:4097"
                     /db_xref="HPRD:05383"
                     /db_xref="MIM:604949"
                     /translation="
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
"
     misc_feature    180..>413
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /note="Ribosomal protein L7Ae/L30e/S12e/Gadd45 family;
                     Region: Ribosomal_L7Ae; pfam01248"
                     /db_xref="CDD:201684"
     variation       139
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199566315"
     variation       149
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377489263"
     variation       159
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:371764432"
     exon            164..265
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /inference="alignment:Splign:1.39.8"
     variation       182
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371625737"
     variation       236
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375895752"
     exon            266..479
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /inference="alignment:Splign:1.39.8"
     variation       317
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144997883"
     variation       335
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144229332"
     variation       406
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375451298"
     variation       428
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138848476"
     variation       438
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:71512212"
     variation       444
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3138505"
     exon            480..1066
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /inference="alignment:Splign:1.39.8"
     variation       487
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376168420"
     variation       488
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:34954994"
     variation       553
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144775138"
     variation       566
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148149951"
     variation       600
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:5031028"
     variation       606
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:8252"
     variation       615
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:376998051"
     variation       684
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201824646"
     variation       710
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:5031029"
     variation       710
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:112620591"
     variation       711
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370717452"
     variation       748
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17055047"
     variation       798
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56370514"
     variation       855
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3138506"
     variation       927
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189468471"
     variation       985
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:180716901"
     polyA_signal    1047..1052
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
     polyA_site      1066
                     /gene="GADD45G"
                     /gene_synonym="CR6; DDIT2; GADD45gamma; GRP17"
ORIGIN      
gcactcgctggtggtgggcgcgccgtgctgagctctggctgtcagtgtgttcgcccgcgtcccctccgcgctctccgcttgtggataactagctgctggttgatcgcactatgactctggaagaagtccgcggccaggacacagttccggaaagcacagccaggatgcagggtgccgggaaagcgctgcatgagttgctgctgtcggcgcagcgtcagggctgcctcactgccggcgtctacgagtcagccaaagtcttgaacgtggaccccgacaatgtgaccttctgtgtgctggctgcgggtgaggaggacgagggcgacatcgcgctgcagatccattttacgctgatccaggctttctgctgcgagaacgacatcgacatagtgcgcgtgggcgatgtgcagcggctggcggctatcgtgggcgccggcgaggaggcgggtgcgccgggcgacctgcactgcatcctcatttcgaaccccaacgaggacgcctggaaggatcccgccttggagaagctcagcctgttttgcgaggagagccgcagcgttaacgactgggtgcccagcatcaccctccccgagtgacagcccggcggggaccttggtctgatcgacgtggtgacgccccggggcgcctagagcgcggctggctctgtggaggggccctccgagggtgcccgagtgcggcgtggagactggcaggcggggggggcgcctggagagcgaggaggcgcggcctcccgaggaggggcccggtggcggcagggccaggctggtccgagctgaggactctgcaagtgtctggagcggctgctcgcccaggaaggcctaggctaggacgttggcctcagggccaggaaggacagactggccgggcaggcgtgactcagcagcctgcgctcggcaggaaggagcggcgccctggacttggtacagttgcaggagcgtgaaggacttagccgactgcgctgctttttcaaaacggatccgggcaatgcttcgttttctaaaggatgctgctgttgaagctttgaattttacaataaactttttgaaacaaaaaaaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:10912 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:10912 -> Biological process: GO:0000185 [activation of MAPKKK activity] evidence: TAS
            GeneID:10912 -> Biological process: GO:0000186 [activation of MAPKK activity] evidence: IEA
            GeneID:10912 -> Biological process: GO:0006281 [DNA repair] evidence: TAS
            GeneID:10912 -> Biological process: GO:0006469 [negative regulation of protein kinase activity] evidence: IEA
            GeneID:10912 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
            GeneID:10912 -> Biological process: GO:0006950 [response to stress] evidence: TAS
            GeneID:10912 -> Biological process: GO:0007275 [multicellular organismal development] evidence: IEA
            GeneID:10912 -> Biological process: GO:0030154 [cell differentiation] evidence: IEA
            GeneID:10912 -> Biological process: GO:0051726 [regulation of cell cycle] evidence: IEA
            GeneID:10912 -> Cellular component: GO:0005634 [nucleus] evidence: IEA

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.