Home |
Help |
Advanced search
2024-04-20 19:10:12, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_006694 1574 bp mRNA linear PRI 01-JUL-2013
DEFINITION Homo sapiens jumping translocation breakpoint (JTB), mRNA.
ACCESSION NM_006694
VERSION NM_006694.3 GI:156071502
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1574)
AUTHORS Xu,X.F., Zhou,X.M., Wei,Z.F., Zhang,Z.Y., Ge,J.P., Wei,W.,
Zhou,W.Q., Cheng,W., Hou,J.Q. and Gao,J.P.
TITLE [Downregulation of PAR expression induces the apoptosis of human
prostate cancer PC3 cells and increases the Bcl-2/Bax ratio]
JOURNAL Zhonghua Nan Ke Xue 18 (10), 896-899 (2012)
PUBMED 23297497
REMARK GeneRIF: Downregulation of the PAR expression increases the
Bax/Bcl-2 ratio and Bax expression, and thus induces the G2-M phase
arrest and apoptosis of PC3 cells.
REFERENCE 2 (bases 1 to 1574)
AUTHORS Rousseau,F., Pan,B., Fairbrother,W.J., Bazan,J.F. and Lingel,A.
TITLE The structure of the extracellular domain of the jumping
translocation breakpoint protein reveals a variation of the midkine
fold
JOURNAL J. Mol. Biol. 415 (1), 22-28 (2012)
PUBMED 22079049
REMARK GeneRIF: The JTB structure has a distant relationship to the
midkine/pleiotrophin fold, particularly in the conservation of
distinctive disulfide bridge patterns.
REFERENCE 3 (bases 1 to 1574)
AUTHORS Liu,Y.P., Yang,X.N., Jazag,A., Pan,J.S., Hu,T.H., Liu,J.J.,
Guleng,B. and Ren,J.L.
TITLE HBsAg inhibits the translocation of JTB into mitochondria in HepG2
cells and potentially plays a role in HCC progression
JOURNAL PLoS ONE 7 (5), E36914 (2012)
PUBMED 22615844
REMARK GeneRIF: Silencing of the JTB resulted in an increase in the
phosphorylation of p65 in HepG2 cells.
REFERENCE 4 (bases 1 to 1574)
AUTHORS Platica,M., Ionescu,A., Ivan,E., Holland,J.F., Mandeli,J. and
Platica,O.
TITLE PAR, a protein involved in the cell cycle, is functionally related
to chromosomal passenger proteins
JOURNAL Int. J. Oncol. 38 (3), 777-785 (2011)
PUBMED 21225229
REMARK GeneRIF: Due to its involvement in cell cycle and its
overexpression in several human cancers PAR could represent an
attractive target for therapeutic intervention.
REFERENCE 5 (bases 1 to 1574)
AUTHORS Pan,J.S., Cai,J.Y., Xie,C.X., Zhou,F., Zhang,Z.P., Dong,J.,
Xu,H.Z., Shi,H.X. and Ren,J.L.
TITLE Interacting with HBsAg compromises resistance of jumping
translocation breakpoint protein to ultraviolet radiation-induced
apoptosis in 293FT cells
JOURNAL Cancer Lett. 285 (2), 151-156 (2009)
PUBMED 19487072
REMARK GeneRIF: Overexpression of JTB conferred resistance to apoptosis
induced by ultraviolet radiation
REFERENCE 6 (bases 1 to 1574)
AUTHORS Wong,N., Chan,A., Lee,S.W., Lam,E., To,K.F., Lai,P.B., Li,X.N.,
Liew,C.T. and Johnson,P.J.
TITLE Positional mapping for amplified DNA sequences on 1q21-q22 in
hepatocellular carcinoma indicates candidate genes over-expression
JOURNAL J. Hepatol. 38 (3), 298-306 (2003)
PUBMED 12586295
REMARK GeneRIF: Among ten hepatocellular carcinoma cases with amplicon
1q21-q22, significant gene expression level of JTB, SHC1, CCT3 and
COPA in the tumors than the paired adjacent non-malignant liver
tissues.
REFERENCE 7 (bases 1 to 1574)
AUTHORS Platica,O., Chen,S., Ivan,E., Lopingco,M.C., Holland,J.F. and
Platica,M.
TITLE PAR, a novel androgen regulated gene, ubiquitously expressed in
normal and malignant cells
JOURNAL Int. J. Oncol. 16 (5), 1055-1061 (2000)
PUBMED 10762645
REFERENCE 8 (bases 1 to 1574)
AUTHORS Hatakeyama,S., Osawa,M., Omine,M. and Ishikawa,F.
TITLE JTB: a novel membrane protein gene at 1q21 rearranged in a jumping
translocation
JOURNAL Oncogene 18 (12), 2085-2090 (1999)
PUBMED 10321732
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
AL358472.54.
On Aug 16, 2007 this sequence version replaced gi:38455406.
Sequence Note: The RefSeq transcript and protein were derived from
genomic sequence to make the sequence consistent with the reference
genome assembly. The genomic coordinates used for the transcript
record were based on alignments.
##Evidence-Data-START##
Transcript exon combination :: BC000996.2, BC000499.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025088 [ECO:0000348]
##Evidence-Data-END##
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-806 AL358472.54 57796-58601 c
807-844 AL358472.54 57602-57639 c
845-927 AL358472.54 57319-57401 c
928-1007 AL358472.54 56452-56531 c
1008-1574 AL358472.54 54895-55461 c
FEATURES Location/Qualifiers
source 1..1574
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1q21"
gene 1..1574
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/note="jumping translocation breakpoint"
/db_xref="GeneID:10899"
/db_xref="HGNC:6201"
/db_xref="HPRD:05240"
/db_xref="MIM:604671"
exon 1..806
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/inference="alignment:Splign:1.39.8"
polyA_signal 72..77
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
polyA_site 91
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
variation 362
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="c"
/replace="g"
/db_xref="dbSNP:3182946"
variation 511
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="a"
/replace="c"
/db_xref="dbSNP:11543275"
misc_feature 514..516
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/note="upstream in-frame stop codon"
variation 623
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="c"
/replace="t"
/db_xref="dbSNP:11543274"
CDS 724..1164
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/note="protein JTB; prostate androgen-regulated protein;
jumping translocation breakpoint protein"
/codon_start=1
/product="protein JTB precursor"
/protein_id="NP_006685.1"
/db_xref="GI:5729889"
/db_xref="CCDS:CCDS1057.1"
/db_xref="GeneID:10899"
/db_xref="HGNC:6201"
/db_xref="HPRD:05240"
/db_xref="MIM:604671"
/translation="
MLAGAGRPGLPQGRHLCWLLCAFTLKLCQAEAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRLFWKFEGAVVCVALIFACLVIIRQRQLDRKALEKVRKQIESI
"
sig_peptide 724..813
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/inference="COORDINATES: ab initio prediction:SignalP:4.0"
misc_feature 811..1152
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/note="Jumping translocation breakpoint protein (JTB);
Region: JTB; pfam05439"
/db_xref="CDD:114179"
mat_peptide 814..1161
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/product="Protein JTB"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (O76095.1)"
misc_feature 1039..1101
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O76095.1);
transmembrane region"
variation 769
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="c"
/replace="t"
/db_xref="dbSNP:34686244"
exon 807..844
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/inference="alignment:Splign:1.39.8"
exon 845..927
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/inference="alignment:Splign:1.39.8"
variation 868..869
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="g"
/replace="t"
/db_xref="dbSNP:11543276"
exon 928..1007
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/inference="alignment:Splign:1.39.8"
exon 1008..1574
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/inference="alignment:Splign:1.39.8"
STS 1087..1294
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/standard_name="RH63845"
/db_xref="UniSTS:41500"
variation 1124
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="a"
/replace="g"
/db_xref="dbSNP:1062713"
variation 1161..1162
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="a"
/replace="g"
/db_xref="dbSNP:11543272"
variation 1184..1185
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="c"
/replace="t"
/db_xref="dbSNP:11543271"
variation 1249
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="c"
/replace="t"
/db_xref="dbSNP:11543270"
variation 1295
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/replace="a"
/replace="g"
/db_xref="dbSNP:11543273"
polyA_signal 1312..1317
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
polyA_site 1331
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
STS 1337..1456
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
/standard_name="RH11825"
/db_xref="UniSTS:56352"
polyA_signal 1549..1554
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
polyA_site 1574
/gene="JTB"
/gene_synonym="hJT; HJTB; HSPC222; PAR"
ORIGIN
acacagcttctccactggatcatcggtggcgatgaaggggcggctggggaaggatgtcagagaaaccagaagcttgacggtgaatcctcgggttttaaggagagagcaaagtcctgagagggcgacgtattgtccctgctcacctagcccagaatgaacaaacacgcgccagccagggagcagcgagccgagaattcggacgagcctctgcaaccgccatttgccgttctcgcaaagactaccaagaccacaatgcaacggggcgccgagctaattcccagtgagcagcaggcgaggcgccaccgacgcggaagactataagccccagcgggcgacgaccgaacgcccccgggaacaccgggccccgagctcggtcccgcgcccgaggatcctccacggggctagatggctgcgtcgggggcgggagcggaggtgagcgggcgctagggccgcgagcccccgccggcccttcctccagcgccctgcggaccccgcagaaggcgctcgcctccctagcccgcaaaaacatatcgatttttctcgctgtggcaacggggacgtcctgatagatcctctgctccaataggcaactccggccttccctgccctgacctggaacctctgggagggctgcagagtaagtgccgcctctgcgctccgacggaggcacgaggcctgtggagtaggtccctctgttccgacaggtgcgacacttggcgctccatgcttgcgggtgccgggaggcctggcctcccccagggccgccacctctgctggttgctctgtgctttcaccttaaagctctgccaagcagaggctcccgtgcaggaagagaagctgtcagcaagcacctcaaatttgccatgctggctggtggaagagtttgtggtagcagaagagtgctctccatgctctaatttccgggctaaaactacccctgagtgtggtcccacaggatatgtagagaaaatcacatgcagctcatctaagagaaatgagttcaaaagctgccgctcagctttgatggaacaacgcttattttggaagttcgaaggggctgtcgtgtgtgtggccctgatcttcgcttgtcttgtcatcattcgtcagcgacaattggacagaaaggctctggaaaaggtccggaagcaaatcgagtccatatagctacattccacccttgtatcctgggtcttagagaccctatctcagacagtgaaagtgaaatggactgatttgcactcttggttctttggagccttgtggtggaatccccttttccccatcttcttctttcagatcattaatgagcagaataaaaagagtaaaatggtttccttcccttctgtaacttggagcaggaagtcatgggggcagagagggaaaggaggtggttacttaaggccccaatctaccaagtcttccccaccacttctcccttgttttccccctcttctactacttatttcaaacttctgggatacaatttcagctaaaacgtttatttctcactcaaaacttatttcccctcaaccctatacccaaagaagaaataaaatcacagatacataacagaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10899 -> Molecular function: GO:0019901 [protein kinase binding] evidence: IDA
GeneID:10899 -> Biological process: GO:0000910 [cytokinesis] evidence: IMP
GeneID:10899 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:10899 -> Biological process: GO:0007067 [mitosis] evidence: IMP
GeneID:10899 -> Biological process: GO:0042127 [regulation of cell proliferation] evidence: IEA
GeneID:10899 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: IEA
GeneID:10899 -> Biological process: GO:0045860 [positive regulation of protein kinase activity] evidence: IMP
GeneID:10899 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
GeneID:10899 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA
GeneID:10899 -> Cellular component: GO:0005813 [centrosome] evidence: IDA
GeneID:10899 -> Cellular component: GO:0005819 [spindle] evidence: IDA
GeneID:10899 -> Cellular component: GO:0005887 [integral to plasma membrane] evidence: TAS
GeneID:10899 -> Cellular component: GO:0016020 [membrane] evidence: TAS
GeneID:10899 -> Cellular component: GO:0030496 [midbody] evidence: IDA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.