GGRNA Home | Help | Advanced search

2019-03-25 14:32:11, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_006581              12815 bp    mRNA    linear   PRI 17-APR-2013
DEFINITION  Homo sapiens fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
            (FUT9), mRNA.
ACCESSION   NM_006581
VERSION     NM_006581.3  GI:139394625
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 12815)
  AUTHORS   Buffone,A. Jr., Mondal,N., Gupta,R., McHugh,K.P., Lau,J.T. and
            Neelamegham,S.
  TITLE     Silencing alpha1,3-fucosyltransferases in human leukocytes reveals
            a role for FUT9 enzyme during E-selectin-mediated cell adhesion
  JOURNAL   J. Biol. Chem. 288 (3), 1620-1633 (2013)
   PUBMED   23192350
  REMARK    GeneRIF: FUT9 plays a significant role during human, but not mouse,
            E-selectin-mediated cell adhesion.
REFERENCE   2  (bases 1 to 12815)
  AUTHORS   Gouveia,R., Schaffer,L., Papp,S., Grammel,N., Kandzia,S.,
            Head,S.R., Kleene,R., Schachner,M., Conradt,H.S. and Costa,J.
  TITLE     Expression of glycogenes in differentiating human NT2N neurons.
            Downregulation of fucosyltransferase 9 leads to decreased Lewis(x)
            levels and impaired neurite outgrowth
  JOURNAL   Biochim. Biophys. Acta 1820 (12), 2007-2019 (2012)
   PUBMED   23000574
  REMARK    GeneRIF: Downregulation of fucosyltransferase 9 leads to decreased
            Lewis(x) levels and impaired neurite outgrowth.
REFERENCE   3  (bases 1 to 12815)
  AUTHORS   Sikora,M., Ferrer-Admetlla,A., Laayouni,H., Menendez,C., Mayor,A.,
            Bardaji,A., Sigauque,B., Mandomando,I., Alonso,P.L.,
            Bertranpetit,J. and Casals,F.
  TITLE     A variant in the gene FUT9 is associated with susceptibility to
            placental malaria infection
  JOURNAL   Hum. Mol. Genet. 18 (16), 3136-3144 (2009)
   PUBMED   19460885
  REMARK    GeneRIF: A single nucleotide polymorphism in FUT9, rs3811070, was
            significantly associated with placental malaria infection.
REFERENCE   4  (bases 1 to 12815)
  AUTHORS   Brito,C., Kandzia,S., Graca,T., Conradt,H.S. and Costa,J.
  TITLE     Human fucosyltransferase IX: specificity towards N-linked
            glycoproteins and relevance of the cytoplasmic domain in
            intra-Golgi localization
  JOURNAL   Biochimie 90 (9), 1279-1290 (2008)
   PUBMED   18395013
  REMARK    GeneRIF: FUT9 was found to be a trans-Golgi and trans-Golgi network
            (TGN) glycosyltransferase from confocal immunofluorescence
            co-localization with the markers of the secretory pathway
            beta4-galactosyltransferase (trans-Golgi and TGN) and TGN-46 (TGN)
REFERENCE   5  (bases 1 to 12815)
  AUTHORS   Bogoevska,V., Horst,A., Klampe,B., Lucka,L., Wagener,C. and
            Nollau,P.
  TITLE     CEACAM1, an adhesion molecule of human granulocytes, is fucosylated
            by fucosyltransferase IX and interacts with DC-SIGN of dendritic
            cells via Lewis x residues
  JOURNAL   Glycobiology 16 (3), 197-209 (2006)
   PUBMED   16282604
  REMARK    GeneRIF: FUTIX plays a key role in the synthesis of Lex groups of
            CEACAM1
REFERENCE   6  (bases 1 to 12815)
  AUTHORS   Nakayama,F., Nishihara,S., Iwasaki,H., Kudo,T., Okubo,R.,
            Kaneko,M., Nakamura,M., Karube,M., Sasaki,K. and Narimatsu,H.
  TITLE     CD15 expression in mature granulocytes is determined by alpha
            1,3-fucosyltransferase IX, but in promyelocytes and monocytes by
            alpha 1,3-fucosyltransferase IV
  JOURNAL   J. Biol. Chem. 276 (19), 16100-16106 (2001)
   PUBMED   11278338
REFERENCE   7  (bases 1 to 12815)
  AUTHORS   Cailleau-Thomas,A., Coullin,P., Candelier,J.J., Balanzino,L.,
            Mennesson,B., Oriol,R. and Mollicone,R.
  TITLE     FUT4 and FUT9 genes are expressed early in human embryogenesis
  JOURNAL   Glycobiology 10 (8), 789-802 (2000)
   PUBMED   10929005
REFERENCE   8  (bases 1 to 12815)
  AUTHORS   Nishihara,S., Iwasaki,H., Kaneko,M., Tawada,A., Ito,M. and
            Narimatsu,H.
  TITLE     Alpha1,3-fucosyltransferase 9 (FUT9; Fuc-TIX) preferentially
            fucosylates the distal GlcNAc residue of polylactosamine chain
            while the other four alpha1,3FUT members preferentially fucosylate
            the inner GlcNAc residue
  JOURNAL   FEBS Lett. 462 (3), 289-294 (1999)
   PUBMED   10622713
REFERENCE   9  (bases 1 to 12815)
  AUTHORS   Kaneko,M., Kudo,T., Iwasaki,H., Ikehara,Y., Nishihara,S.,
            Nakagawa,S., Sasaki,K., Shiina,T., Inoko,H., Saitou,N. and
            Narimatsu,H.
  TITLE     Alpha1,3-fucosyltransferase IX (Fuc-TIX) is very highly conserved
            between human and mouse; molecular cloning, characterization and
            tissue distribution of human Fuc-TIX
  JOURNAL   FEBS Lett. 452 (3), 237-242 (1999)
   PUBMED   10386598
REFERENCE   10 (bases 1 to 12815)
  AUTHORS   Kaneko,M., Kudo,T., Iwasaki,H., Shiina,T., Inoko,H., Kozaki,T.,
            Saitou,N. and Narimatsu,H.
  TITLE     Assignment of the human alpha 1,3-fucosyltransferase IX gene (FUT9)
            to chromosome band 6q16 by in situ hybridization
  JOURNAL   Cytogenet. Cell Genet. 86 (3-4), 329-330 (1999)
   PUBMED   10575236
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from CK904220.1, BC036101.1,
            AL512406.14 and CK299829.1.
            On Apr 3, 2007 this sequence version replaced gi:36951077.
            
            Summary: The protein encoded by this gene belongs to the
            glycosyltransferase family. It is localized to the golgi, and
            catalyzes the last step in the biosynthesis of Lewis X (LeX)
            antigen, the addition of a fucose to precursor polysaccharides.
            This protein is one of the few fucosyltransferases that synthesizes
            the LeX oligosaccharide (CD15) expressed in the organ buds
            progressing in mesenchyma during embryogenesis. It is also
            responsible for the expression of CD15 in mature granulocytes. A
            common haplotype of this gene has also been associated with
            susceptibility to placental malaria infection. [provided by RefSeq,
            Nov 2011].
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no single transcript was available
            for the full length of the gene. The extent of this transcript is
            supported by transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CK904220.1, AB023021.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025082, ERS025098 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-528               CK904220.1         1-528
            529-1049            BC036101.1         506-1026
            1050-12225          AL512406.14        36267-47442
            12226-12815         CK299829.1         1-590               c
FEATURES             Location/Qualifiers
     source          1..12815
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6q16"
     gene            1..12815
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /note="fucosyltransferase 9 (alpha (1,3)
                     fucosyltransferase)"
                     /db_xref="GeneID:10690"
                     /db_xref="HGNC:4020"
                     /db_xref="MIM:606865"
     exon            1..244
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /inference="alignment:Splign:1.39.8"
     variation       70
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367659719"
     variation       145
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369440045"
     variation       216
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:117178087"
     variation       223
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147519286"
     exon            245..333
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /inference="alignment:Splign:1.39.8"
     STS             266..1548
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /db_xref="UniSTS:480468"
     variation       305
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:118160761"
     variation       326
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:371951791"
     misc_feature    333..335
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /note="upstream in-frame stop codon"
     exon            334..12798
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /inference="alignment:Splign:1.39.8"
     CDS             342..1421
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /EC_number="2.4.1.152"
                     /note="fucT-IX; fucosyltransferase IX; galactoside
                     3-L-fucosyltransferase"
                     /codon_start=1
                     /product="alpha-(1,3)-fucosyltransferase"
                     /protein_id="NP_006572.2"
                     /db_xref="GI:139394626"
                     /db_xref="CCDS:CCDS5033.1"
                     /db_xref="GeneID:10690"
                     /db_xref="HGNC:4020"
                     /db_xref="MIM:606865"
                     /translation="
MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISTCKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN
"
     misc_feature    357..1415
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /note="Glycosyltransferase family 10 (fucosyltransferase);
                     Region: Glyco_transf_10; pfam00852"
                     /db_xref="CDD:144445"
     misc_feature    375..437
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (Q9Y231.2);
                     transmembrane region"
     variation       353
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200346772"
     variation       361
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146406553"
     variation       369
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376205938"
     variation       380
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17853548"
     variation       411
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:188064752"
     variation       508
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139267189"
     variation       625
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144101900"
     variation       626
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145042649"
     variation       631
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148689797"
     variation       647
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375058208"
     variation       653
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190540423"
     variation       662
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139516318"
     variation       682
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376403164"
     variation       744
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:199945143"
     variation       756
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:79503863"
     variation       770
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142240115"
     variation       773
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151138332"
     variation       794
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368301077"
     variation       834
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:371085883"
     variation       872
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375082399"
     variation       878
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201945905"
     variation       918
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:367998184"
     variation       934
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199802287"
     STS             977..1570
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /standard_name="PMC26954P1"
                     /db_xref="UniSTS:272366"
     variation       987
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146949446"
     variation       995
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375887169"
     variation       1019
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147593239"
     variation       1050
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3811069"
     variation       1103
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367604602"
     variation       1118
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150246632"
     variation       1220
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138917684"
     variation       1244
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:150684253"
     variation       1257
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371644802"
     variation       1324
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142793962"
     variation       1355
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201110089"
     variation       1356
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201254420"
     variation       1364
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146087318"
     variation       1403
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374869820"
     variation       1412
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375490773"
     variation       1413
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9986564"
     variation       1428
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138904451"
     variation       1450
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149412113"
     variation       1488
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:147507075"
     variation       1545
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139604379"
     variation       1549
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145125486"
     variation       1578
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41285452"
     variation       1630
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:111391528"
     variation       1665
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:192681787"
     variation       1681
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4078339"
     variation       1790
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147140326"
     variation       1854
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:377446515"
     variation       1865
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140253262"
     variation       1866
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142227925"
     variation       1892
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4454149"
     variation       1906
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376553879"
     variation       2016
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4440473"
     variation       2077
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115435828"
     STS             2114..2411
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /standard_name="SHGC-146306"
                     /db_xref="UniSTS:175139"
     variation       2348
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4270796"
     variation       2363
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:79306788"
     variation       2518
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:3934926"
     polyA_signal    2549..2554
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
     polyA_site      2574
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
     polyA_signal    2707..2712
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
     polyA_site      2730
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
     variation       2759
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376752826"
     variation       2760
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11966374"
     variation       2788
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4275065"
     variation       2799
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4132773"
     variation       2817
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:113240732"
     variation       2944..2945
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:35152153"
     variation       2965
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184747818"
     variation       2966
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139188193"
     variation       3063
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149940163"
     variation       3196
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:146485130"
     variation       3245
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4240604"
     variation       3341
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187971323"
     variation       3421
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112411644"
     variation       3472
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140612562"
     variation       3578
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:180934478"
     variation       3625
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145670755"
     STS             3713..3883
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /standard_name="D1S1425"
                     /db_xref="UniSTS:149621"
     variation       3718
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186378254"
     variation       3744
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146552186"
     variation       3793
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374180376"
     variation       3815
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149131395"
     variation       3859
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:189732252"
     variation       3954
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:375939430"
     variation       4115
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:9373717"
     variation       4139
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11965677"
     variation       4171
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:372391899"
     variation       4180
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181738630"
     variation       4293
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:9404452"
     variation       4327
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11968616"
     variation       4333
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:143227426"
     variation       4406
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76422396"
     variation       4415..4416
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="gt"
                     /db_xref="dbSNP:71834434"
     variation       4415
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7740756"
     variation       4417..4418
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="ac"
                     /db_xref="dbSNP:72469333"
     variation       4417
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:77041056"
     variation       4418
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:78853432"
     variation       4435..4436
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="ca"
                     /db_xref="dbSNP:34744508"
     variation       4450
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376333021"
     variation       4493
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191002913"
     variation       4511
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148386293"
     variation       4564
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12212512"
     variation       4580
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375017764"
     variation       4644
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374289215"
     variation       4775
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:7746212"
     variation       4796
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:4143938"
     variation       4849
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:186445016"
     variation       5054
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:189736854"
     variation       5079
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141572572"
     variation       5171..5172
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34525493"
     variation       5295
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:147099677"
     variation       5325
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:182631149"
     variation       5334
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138440138"
     variation       5364
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:112743774"
     variation       5371
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:188192149"
     variation       5387
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191284418"
     variation       5394
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368868087"
     variation       5399
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:11295841"
     variation       5407
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201516986"
     variation       5439
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:7738590"
     variation       5458..5460
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:11393475"
     variation       5469..5470
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:68015810"
     variation       5475
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183654394"
     variation       5492
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147156956"
     variation       5525
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187497977"
     variation       5543
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:76183549"
     variation       5598
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192116425"
     variation       5642
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:139473815"
     variation       5645
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:149252087"
     variation       5796
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:28647951"
     variation       5811
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144433594"
     variation       5934
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:148492376"
     variation       5959
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9373720"
     variation       5968
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144125411"
     variation       6036..6039
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="tctc"
                     /db_xref="dbSNP:200493886"
     variation       6063
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:72927046"
     variation       6077
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:4632899"
     variation       6085..6087
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:5878427"
     variation       6096
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200825201"
     variation       6121
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12206407"
     variation       6195
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146488946"
     variation       6307
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:184604730"
     variation       6379
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:115490308"
     variation       6494
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139900799"
     variation       6512
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144318935"
     variation       6638
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9386381"
     variation       6650..6651
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="at"
                     /replace="gc"
                     /db_xref="dbSNP:71541190"
     variation       6650
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:9386382"
     variation       6651
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9399842"
     variation       6675
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187830264"
     variation       6704
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:376317880"
     variation       6737
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:80108849"
     variation       6851
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374185888"
     variation       6877
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:201421519"
     variation       6881
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:17726532"
     variation       6964
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:34735491"
     variation       7018
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:191230921"
     variation       7028
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184466529"
     variation       7038
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:372973723"
     variation       7072
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368926824"
     variation       7075
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146586534"
     variation       7106
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:113368251"
     variation       7134
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:13220369"
     variation       7151
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:150204357"
     variation       7269
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189833572"
     variation       7340
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:12213730"
     variation       7361
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:9499629"
     variation       7411
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181438250"
     variation       7422
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145708981"
     variation       7462
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4602726"
     variation       7484
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149007064"
     variation       7493
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184926845"
     variation       7536
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:147103029"
     variation       7549
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:9386383"
     variation       7570
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:4240605"
     variation       7572
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:4240606"
     variation       7582
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:188882329"
     variation       7710
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9391096"
     variation       7745
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4621639"
     variation       7746
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:9499631"
     variation       7900
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368330962"
     variation       7903
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:181668455"
     variation       7922
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138486685"
     variation       7948
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:4840245"
     variation       7975
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:77619737"
     variation       7980
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:17056459"
     variation       8111
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:112747298"
     variation       8144..8145
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34977836"
     variation       8183
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:186323922"
     variation       8199
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:146718356"
     variation       8283
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148229099"
     variation       8305
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373402201"
     variation       8395
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191161485"
     variation       8459
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:367906539"
     variation       8501
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:9386384"
     variation       8535
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:180792559"
     variation       8556
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:186131597"
     variation       8565
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:377579020"
     variation       8610
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141199009"
     variation       8612
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:150719779"
     variation       8712
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:73757755"
     variation       8723
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182793557"
     variation       8758
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375778662"
     variation       8804
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35282634"
     variation       8805
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373719614"
     variation       8807
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:375937379"
     variation       8854
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187097714"
     variation       8899
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4475334"
     variation       8987
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:9399845"
     variation       9134
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190374221"
     variation       9170
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:183013050"
     variation       9176..9177
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:34933491"
     variation       9223
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:138995514"
     variation       9240
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142679943"
     variation       9294
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73757758"
     variation       9380
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17056460"
     variation       9412
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374828540"
     variation       9424
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7745248"
     variation       9492
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146022547"
     variation       9630..9633
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="aatc"
                     /db_xref="dbSNP:111592324"
     variation       9741
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9499636"
     variation       9749
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11969261"
     variation       9787
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139961371"
     variation       9914
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369027282"
     variation       10036
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6571134"
     variation       10089
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:187682035"
     variation       10256
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143416895"
     variation       10271
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:144544540"
     variation       10300
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:148756964"
     variation       10346
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:4582393"
     variation       10372
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:4458699"
     variation       10443
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75908201"
     variation       10487
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:367809118"
     variation       10625
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:6571135"
     variation       10658
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:193150196"
     variation       10693
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:377145618"
     variation       10720
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:7745157"
     variation       10748
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:184437939"
     variation       10756
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187467468"
     variation       10761
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:192716978"
     variation       10828
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:118079189"
     variation       10861
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:142299468"
     variation       10897
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:184048610"
     variation       10932
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:34697788"
     variation       10958
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:112067318"
     variation       11020
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141506285"
     variation       11054
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:188735495"
     variation       11112
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:181546641"
     variation       11220..11221
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:35113497"
     variation       11238
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:7749759"
     STS             11458..11583
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /standard_name="RH27006"
                     /db_xref="UniSTS:88887"
     variation       11556
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147752243"
     variation       11589
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142622296"
     variation       11628
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146851289"
     variation       11686
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:77748719"
     variation       11748
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12215829"
     variation       11774
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:71723075"
     variation       11845
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:184629432"
     variation       11846
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:189444283"
     variation       11911
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:12190371"
     variation       11927
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:116580204"
     variation       11953
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:138890793"
     variation       11984
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:182289591"
     variation       12042
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77548676"
     variation       12067
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187423159"
     variation       12098
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56142608"
     variation       12113
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:17726854"
     variation       12153
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:118056166"
     variation       12174
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:190677682"
     variation       12202
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:115070494"
     variation       12225
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:3827786"
     variation       12352
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:180976890"
     STS             12361..12705
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /standard_name="SHGC-84631"
                     /db_xref="UniSTS:102955"
     variation       12369
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12213218"
     variation       12382
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80112371"
     STS             12470..12701
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /standard_name="SHGC-56489"
                     /db_xref="UniSTS:30505"
     variation       12594
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367669947"
     STS             12663..12764
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /standard_name="SHGC-36057"
                     /db_xref="UniSTS:24362"
     variation       12674
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185416180"
     polyA_signal    12774..12779
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
     polyA_site      12798
                     /gene="FUT9"
                     /gene_synonym="Fuc-TIX"
ORIGIN      
gcggcagtagctgtagcagcttcagcgaagccggagatgggcagagagcgcgcgcggcgcagcagctccagattcactgctctcccctgcagctccccgcgcccccgccgctgtcgctgcctcggtgtcccccagccccagtcgcgctcttaggacagcgccgccaccgccgcctggccctgcctgcctcctgcgccgcgcagccctcgcgagcgccccggatggcgctttacccctaggaccgatttagaatgtaataactcaaggatttgataatacagtgaagtagtataacaactgtctacgtgcttcccatgatatgttctctatattgaaaaattatgacatcaacatccaaaggaattcttcgcccatttttaattgtctgcattatcctgggctgtttcatggcatgtcttctcatttacatcaaacctaccaacagctggatcttcagtccaatggaatcagccagctctgtgctgaaaatgaaaaacttcttttccaccaaaactgattattttaatgaaactactattctggtgtgggtgtggccatttgggcagacctttgaccttacatcctgccaagcaatgttcaacatccaaggatgccatctcacaacggaccgttcactgtacaacaaatcccatgcagttctgatccatcaccgagacatcagttgggatctgacaaatttacctcagcaagctaggccacccttccagaaatggatttggatgaatttggaatcaccaactcacactccccaaaagagtggcattgagcacttgtttaacctgactctgacttaccgccgtgattcagatatccaagtgccttatggcttcttgacggtaagcacaaatcccttcgtgtttgaagtgccaagcaaagagaaattggtgtgctgggttgtgagtaactggaaccctgagcatgccagagtcaagtattacaatgagctaagcaaaagcattgaaatccatacctacgggcaagcatttggagaatatgtcaatgataaaaatttgattcctaccatatctacttgtaaattttatctttcctttgaaaattcaatccacaaggattacatcacggaaaagctatacaatgcttttctggctggctctgtacctgttgttctgggaccatctagggaaaactatgagaattatattccagcagattcattcattcatgtggaagattataactctcccagtgagctagcaaagtatctgaaggaagtcgacaaaaacaataagttataccttagttactttaactggaggaaggatttcactgtaaatcttccacgattttgggaatcacatgcatgtttggcttgcgatcatgtgaaaaggcatcaagaatataagtctgttggtaatttagagaaatggttttggaattaaaatttttcatcacttgcacacttgataaatattttgatgagatatcatccaagtattgaggataagaagagatgcaacatactacttttgtgtcacaatttatttttatcaccctctctagggtaacgtgtatattttggtggagatttttaaaagctcagcatgagcaatcattccattcggttttaaattatcctgtatatacctaattatgtgcactggagagtaatttattcttcattatcatttgtaaacattgttttttcacatttttgtagttgtccataatgtaagcttgtggtttgattattgtttccacactgatcagctgtttaatctatttgggaaatgaagatgcacatcttaaagtatgaaaaattttcactaagtattacaatgtctagttccaactttgcatactataacagaggaagaacatgttgcgattgaattctaacctctttgactccgaagatgaatgaagtgtataactgtctctatttgatctattttttttacctgtttatcacatttgtgaaggtgaaattattcatggagtgaataagaaagatatgaagcagaactgttctattcgggaagctattagacttctcatttattttcattaagctgatttgcagctacttattctcatggtcttaaattaaattattcaagtatttttaaatatccaatttgttgtgattttcagcacctgggaagtaatcccaataatactttagaaaatctaagacagttctttctgctactgatgacactcattgtcataataaaacaaataatttcctcaaataacaaagaaaaatgatacctataaatatatttataaatggtgtcatttatgaacaatgtttaattatgtatcaatttaagatttttttctgaagccctaatatttaaaatggtcttattttaccatatggatataagatttggctcataatgatgagccctatcatttgatttgagttctatcatttaagagagcctaaataaaattatcatcaaggtattaaatataagacgttaaatataataaagtggggatatatagaaaacacacagtgttagcacacagtaagatctcaatgcacatttgttggatgaataaataaatgcaattgaattcccagaaaaatgattgtttcaaggaagtgacagttctactttagaagtactaattggagatgacttttatatcccattttggtaattattcatacatagcacatatgaccatgatgttcagggctttatagaaccaaataaacctaccattacatgaaaattttgaagagtatattcctgaacttgcagctgcctatagcattctcctccataaggctagaggagagctggatataagcagagatcgtaggtgaaaaaagatgggccattaaggattcttcaaggaaaacattcctcaaaatgatctttagtgcctttattcctttcaggccaataatccacccaaaaattagaatgttctgagacatccatttgggtctatttgtgacttattcgtattacaaattgacatcagcaaaattcaaaaagaattcagtaaaaagggcatagatccagctatccagactatcttgtgagagaataagctcaccccagcaccagaaagatttgagcagaggaatattcctgtaatgaatagaggattgtttgattctcaggtatatttcttaagccaagattgaatgcagtgtcaggcactgccttaacacccacagagataagatgaacaaggtactatcactgcctaaaatgagcttacaattaagtggatagacatataaaagcttcctttcaattcagcctgagactgtttatatgcatgtgctactccgaatgacgtttgtatgggtcaatgctgatttaatggggaaaaaaagtagaaaatttccccaattgcttagctgtttgacatgtttctgagctgcaaactttgtcaactcttttgacccaacatattattctctccgtattatctcttctaaccacaatgcattaagaaataatatttttatgtggatgtcctcctcaataagtaaagatctccatccatatttaattaattggtaagacagtcaaattcatacatttacatttactttgtcaaattttttggtctataaaaagcatagagatctaaagaggatacactgctaacaagtttagaaagcacctgcttttttttattattattatttttgtgatagagtcttgctctgtcgcccaggccggagtgcagtggtgcagtctcggctcactgcaacctcggcctcccaggttcaagtgattctcctgtatcagcctcccgagtagctaggattacaggcgtgtaccactatgcctggctagtttttgtatttttagtagagatgggtttcactgtgttggccaggctggtcttgaactcctgacctcaaatgatccacttgcctcagcctcccaaagtgctgggattacaggtatgagccactgtgtctggcccacctgttttttttgaaggcagaaaaacattcaatattaaaagcattcaatattatttcaacctgccttggctctagtgaatgttcatgatttgaaagaactgaaagacctaaaggcagtgtctctattgttgactacaaatgtaggctctttgttggactatgactataatcacacactgataatatgacgcaagtagaggcagtactactaagtatctagcaggtgctttgaaaccccattactaagtcccagaagactgtttcctaaatttgaagtggaagaattaaatgactcaatggaaccctttagctgtgggtccattgatgtgtgagttttagagctggaaggaattataattttgttgtttataattgctataatatagaaattataattgcttttctttctacttatgagttaactagatccagagatatttattcaagacacacattcacacacacatacacacacacacacacacaccccacagctagtgacaatagttaagatttggatttaaggatcctatctttctttatcccactttcttttcaatcgcattcataacttattatagaattatgtctcaatttttacaaatgtgaatgtcttattggtatttttagggcctatagaatggtacacctcatgtagaagaacttcgacttttgaaggtatacaataaataaaacatcaaacttgttagcattcgttctggtttaaatattttaggagttgagttcagcagaaggaaatgggctatcactacatttaagtgaaatacaaccctcaagaaagtgtatggttcacagccactcctttaataaatcctgtgggttgcaattctttgtaagaaactcatgaaaaagatatattgattcaacaaaattggtttgctgttgattatacaaaccaataattatgcctagaattaaattgtggacacaaaaaagggaacagaccatttaaaatgttttatttcaaaatatcgaaaagctattaccttcaatactctaaatatttaaatattaattattgtagacatcagtaagaataaataaatgttaatcattatagaccttactaataagaatatatactgaattgtccacatccagagtattacaccctgaacaagaaagacatgagagcctgacagtcatatatattatgacagctgtatatctgacaatatgaagtagaaactgaaaaaaaaaatcatcttagtgggaaacaaatacatgcttaaaattgttatatttactgtaaaactcctgataatcttagattgtgcagaaatgtttcttattttgaggggcttagaaagctcagcgcatttgatgtataaagcaacagaatatttaggaattatttgcggaggctttaaattcttacctccaattggaggttaaatattaaaagaataggaaactatgcctctgatattttttttgtcagcctatttttaaactagattccatgagtcttaaggtaatatcctagaattttttttttgcgtgaattaaagttaccacaaatttcaggtccttaccttatgactgtgtttgatcatatctttgagttcccttgaactctgatctcattttgagaaacattttgagaaacttcttaacaattacaatcgagctgttaaatataacaaacatcagaatctaaaggataagcacagtgcctaatgtacaggagggtcatatcaaatacttgttgaataaatacatgaatgtgataagtggtcctgtaaaatattttttaagagtagtgacaatgtttattggtaccaattggagatgatattttatatttattttgttagtttgtcacctggatgcaaaaggaaggcattttaattcctttctatcttacaacattgtaaagcatcaaaagaagtaacatctcaagaaagattagaaaggatttggatcacgttaacattctatgcaaatattagtaacatatcaactgtttctaaaaggaaagaaaattagtatttaaggagagtataaagtgcgagcactgtgaagggcagatatctattaccaaaccacatggagagaaatatagtctctctcctaacttcattccattgtattgcaatcagtcaattaaggtgattttttttttctggatgtctcaatctagagattttgtagcattttgcaaatgggtatgcttcactactatccacagtgttctcccctttagtaattcatattgaatatatccatattcatatgcattttataaaacagttaacagaatctaaataagatatagccggctaaatctggaatgtgagtgctaccctaggttattagttcaacaaactaattttgagagagccacttaacctctctggaccttgtttgtaagctttcttctagcactattactcttatctaagatcgaaattgatatatgcatgaaattcctaatggaatttcaatgtccatctcaaagtaattttttaggatattccatacagatttccttctcatttctctgtgtagatatttaaagtatgaaattgattatttaaactaatatgtggaaagaacctaatccagagcttggaatatagaaagtgctcaattaactgacattcctcctgtatttcctccctccccttagttgtctatgacttttgaactcactgctcactgacatcttaattgcctgcagaaaaatcaatcatattttaggcattattttgaaatattttagagttttctgtactattcaaactcttattacaaaaatctaaagatatttattgatgcaaaaaatttagggagtcattggaaatacctgaggcaatcccaggctaacaataaaatagcataattttaagtaagctagattgagttcatttgaacatttagttattttttagctcatagttaacatatgtccatgcatttgatttactttaaaaatattttatttaaaaataacctctcaaacaccagttgctttctgtcagttttactcaaagcatgcttcctaggtcacctgacctagaatcaccagaagtgttaacaataccgatttctgggctttgagccatgaaattagaatttcttcaaataatccatgcccccccgtcacccaaaaaaagagcatgcttttaatacatttccaaaattatcctgtttctgctataactggtgaaccatcctgtcctaaactagcagttctcaaacatgcatatgcctttgaaacttcctagatcatctacataaaaatcatttgaaatattgttaataatacacagcttctgaatctctgggtgtgagatgggaccaggaatcttattttaaaaatctccccagatggttctggtgtcctgctagttttgaggttttcatcccacctgtttagatgggtagtattctattaaatatgaggtattacctttctttagttcacctggaatcttcttaaatatatcggtaaagtattctacttcaaaatccaagacattttgtatacctaattatttcacacaagagcgtggaactcaccagtcttgtgacttggggcaggttatttatagtctccagacactttttccagttgcgagttgcttatagtagttcgcgaacctgaatgcacattagaaccatctggagaggctttaaaattgcagatgtccaaaccccacctccagagagctgatctatttagtttgaggaagagcccagaagtctaacaggtgtaaatgttccacaggtaatactaatgcaggcatacctcaggaaatcaccagttctcgtcttggaggaactattaggaaaataaaagattatatatcttgaaaaaaatctctaatttgctttctaggttctaactgcatgtttatattttgcaacaggaaagactggtctagacaattactaggatatatgcttctgtgatctgcttttctattgtatgtgtttaagagaccacattcttgggttccaaagtctccttgtctgataggtaatttgcaattgagatatggcaaagaattgtagcatccaaatttttgacaactacagatttagaattgaatccaaggtctgccattcactagctatgtgcaagttactcaacttctcttatcctcagattttgcagctgtaaagcagaggtagcatatttctgagaaattatattcaggtgactagatatgtgttcaagtgttatcttttattcttataaaagataattgtgaggaatccagtgctattttcacaattttaattctaaaactctgaagacattaaacaggcagtttgtaggaatcattgaaattttatacaagccgaaggaacaacattcagcaaaacggaaacaaataaatacagcatggaagcatatattcatgtttcccataattactaagttacggaaggggtgtgaggagctggcagtggtggtgaataggcattgtttgcattactaaatatatataccatttcttaagataattggaactcaagcagtcctaattttctctccctgttatgagcaatcagtaaatttgtagtcaatttaacttattatcagttggtatagcgcatgtcacagaataggatagcaagaagattctcagagatcattttctggtaaagaaaaaggcctagcaatatttaacagtttgacttaatccatcacttcagctggtccactagttttgacacaggactagttaatgatttgttaggaagtctccatctactcttaaactaatttaaaaaaaagctaaaagttgcttttaatatgttagggtataacttcaataaacaggagtatttatctagtggttcagaaataaaataattgttagccagcctgtgattaaggctaccataattgcataataaatagctttgacgtgaataatctcagttgttcaagtgtacaaatttaaagctgtactatgttagaataaaaaagtaggctcaaggaaaatttctatttttctatatgaaaaagagaatgatattcaaaatagtatttttaagtagtttctaattgtgttcctttaaagagtattagaaatgtctgttatgtcagtaacattagaaaacttcaaaaactgatttatttttctgagttctctggaaaccaaacaattttgaattagttgtgtaagtaaagtaagttaagttatagcttgctggaattttattgtggaaaacaaatatagattttatctgaaaaattttaagggccaattctacagaaagttatgctaacatgctaactttccacacatggctgcattccattttgattaatgagggttcaggaaatagaaaggcagtctctgcagaagcagtatccaaaggctaaattaacaacccaggactaccactcattatgtgagaaatatgggccagagttacaatatcacatctccagtctcagattggcctcattagccaccttcagttccttaaatgagataatcctgaagatgccatccttgtccaaggtgagattgccagaggatatgagctcatctaggatggaatacatgtctccagggactgtaatgagatcaggcttttcatttactggttttctgcctcaagagtccttaagcaaatgaagattatctgattgtctatgtaaacctggaagtagtctactttttagataaaagataatctatcttgaatatttcatatgtgattttaaaataattaatcaaaaaacaaagactatcatatttgagaacaagattttacttagaagggaaaaaaaagaactttcagcttaatcggggttaagggagtaattgtgacaatataaaatggcattgttatagaatccctaaaaggtaaataatgtatgagatgaaggtaggaagtaatgtgtgcttgcagaaatgcaactggtcaaaattacttgaatgaaattgttgaggttaaacatcttcattataataatatgtcttattctgattccaagacaatacgaatgtagagaagagatttttaaatggaaaaagtaaggagctaacaagtctgtacctagattcaagttcacaaagcggcaaaaaggagaaaagtgtcaacaagaaacaagaagaggagtagtaaactaaggatcaaagcccaagttccagttttcacaatctgctgtataattcactaacatttctgagccatagatttttaatctgtaaaaggagtgtgatggactgtacattagaagtacctgagaagctcttaataaatcttgatgaattggttagaaattctaatttaattagcctggcacagtgcacaaactgccatatattcgtgcagatgttttcttcttttcttactgcgcatttccatgtggccatgtcactacaaggggtggggaagaagttaatgtgtaattgcttcaggagctctgaataaaaggttgctgaagcaaaatactgcaatgaagttctgaaaatgaagagttaggactttacatgatttctcttgcctcattccctcaagaatgcacatatagacacacatatgccaatatcttttttatgtagttcaagtataactttgaataaaatgacttacattcaaggaaggtcaaaactattattctgaaacaaaatgtgacaattctagccattatgtgaattgtaagggtcagtaatccataaattatttggatggtaattgtatgttttattaatgtgatgtaattttgcactattgtattgtcatatttaatcaaactcttaaaaataccctgaaacataatgccaaatgtacagtttataggttcgtgttatttctgataagaatttaattgcattgtgctaatagttgtttattgctattaactttctgtgtatgtattattgcgatgcagacccaatagggttattttaagcacactaattagtcatctggatttttatagataaaatcacatgttgatcagaaatcatttttctacttatttttttgtagagtatttttccacacttgaaaaaaacatgattattttatatcaaacatcaacttttctttaaatcttattttagtagctaatgcatgtttgaaataagatgtgttagaaattatatgactatattaaggttgtgtttatattaggtgaaaaattgcatgcaattggtgaatcatgcagctttggggacatttacactgccactcacacacaggctctgtctcaatccgtatgcatgattcacgtcctttcaaaagtcccttttcaacatttggtaaagtgaaaatgttattcatagtgctaatgagccaataaacaatgctgcgtttcttttttctaactgcagcatattgtggtaaattttctcccaaaactttatttttggagttattgttggcaataaatacaacaaattatttgttggcaagtgatacaatttactgtataacaacttaatagtacaaagcatgaagatgtgaaaatatcatcttaaccagtttcattctatgaacataatattctggcagctttttctataactgagaatggtatatctttttatacactgcctaaatcagtactactgccagtcacctgaggtcaggtctgcacaacactaaattgggcaataacatagaacatctaggcagtcttgacagtcaaccagtgtaatcactaggggaagaaaaagtaggcctacccttttacttattaacttaagtaataaaaattgtataaaaatatgaatgttggctgcagaggagcctttacatgcagataatttgaagcagtctttgaaaataacaaaaattattccatttaatgaagggtttgttttgtttagcttttctcttttattcagaaaacatacctgtgcttttgaaagggcttaatcccaaacaggtaatatgtgtggatcaatcatctctcctcccatgaaattaatcattcatggtaatatattaaggctggaacgtagctcttagtgacttaaaacatgacagtaagcatttacactgttggaaggtaatttcattgctatgttattaaaatgatgggaatcctatttatacatttatttatttatttatttacagaagattggttccttccagttcaatttaacagcttcagtgaagttagtataatgataagaaaaattgactgtagctattattccaagtgaaaatcatgcagctgagtcctgctgcatcctgggagcaaagcattaattcaaatgaggagtagtcagtcctagcactgtagacgccgactttaccaaccaagatagtgtatgtgtgtgacattcagctaacattgatctaggcacttagtttgctaccacattgttcccttcattgattgaaactgtaaataacataacactttaaggcagctaagcaaatattttaataagccatgaaaggcaagatgccagagaaaatctgtatattcagctatttggagaactcgtgttttccacaaattaaactggagatgtcatttgaaattttcttcccttaaacatgctgtcacaacatggattccttctcatggatgtctttctaggcttataaatatatggtgtgattgctataattttgtgaaattttattcagcaattaatagtgatttcagcaatatgtactaagattccaaggcagaaataaatgtataaaggatttgagcctgtatgtgtaagaagaaactctctcttcagtcatatttcctaaattcagtgtaagtacctcgctgatttagcactggagttattccttgaatgtgtaaataatgatgttctattctgacctaatgaattcctgtaatgtgaatatttaaaataaaagaattcaatttaaatgtaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:10690 -> Molecular function: GO:0008417 [fucosyltransferase activity] evidence: TAS
            GeneID:10690 -> Molecular function: GO:0046920 [alpha-(1->3)-fucosyltransferase activity] evidence: TAS
            GeneID:10690 -> Biological process: GO:0005975 [carbohydrate metabolic process] evidence: TAS
            GeneID:10690 -> Biological process: GO:0006486 [protein glycosylation] evidence: IEA
            GeneID:10690 -> Biological process: GO:0006486 [protein glycosylation] evidence: TAS
            GeneID:10690 -> Biological process: GO:0007399 [nervous system development] evidence: IEA
            GeneID:10690 -> Biological process: GO:0036065 [fucosylation] evidence: TAS
            GeneID:10690 -> Biological process: GO:0042355 [L-fucose catabolic process] evidence: NAS
            GeneID:10690 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: TAS
            GeneID:10690 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
            GeneID:10690 -> Cellular component: GO:0032580 [Golgi cisterna membrane] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_006572 -> EC 2.4.1.152

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.