2024-04-20 19:48:28, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_006562 1287 bp mRNA linear PRI 07-JUL-2013 DEFINITION Homo sapiens ladybird homeobox 1 (LBX1), mRNA. ACCESSION NM_006562 VERSION NM_006562.4 GI:63054871 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1287) AUTHORS Gao,W., Peng,Y., Liang,G., Liang,A., Ye,W., Zhang,L., Sharma,S., Su,P. and Huang,D. TITLE Association between common variants near LBX1 and adolescent idiopathic scoliosis replicated in the Chinese Han population JOURNAL PLoS ONE 8 (1), E53234 (2013) PUBMED 23308168 REMARK GeneRIF: This study shows that the genetic variants near the LBX1 gene are associated with adolescent idiopathic scoliosis susceptibility in Chinese Han population. REFERENCE 2 (bases 1 to 1287) AUTHORS Fan,Y.H., Song,Y.Q., Chan,D., Takahashi,Y., Ikegawa,S., Matsumoto,M., Kou,I., Cheah,K.S., Sham,P., Cheung,K.M. and Luk,K.D. TITLE SNP rs11190870 near LBX1 is associated with adolescent idiopathic scoliosis in southern Chinese JOURNAL J. Hum. Genet. 57 (4), 244-246 (2012) PUBMED 22301463 REMARK GeneRIF: Single nucleotide polymorphism near LBX1 is significantly associated with adolescent idiopathic scoliosis in southern Chinese. REFERENCE 3 (bases 1 to 1287) AUTHORS Takahashi,Y., Kou,I., Takahashi,A., Johnson,T.A., Kono,K., Kawakami,N., Uno,K., Ito,M., Minami,S., Yanagida,H., Taneichi,H., Tsuji,T., Suzuki,T., Sudo,H., Kotani,T., Watanabe,K., Chiba,K., Hosono,N., Kamatani,N., Tsunoda,T., Toyama,Y., Kubo,M., Matsumoto,M. and Ikegawa,S. TITLE A genome-wide association study identifies common variants near LBX1 associated with adolescent idiopathic scoliosis JOURNAL Nat. Genet. 43 (12), 1237-1240 (2011) PUBMED 22019779 REMARK GeneRIF: A genome-wide association study identifies common variants near LBX1 associated with adolescent idiopathic scoliosis Publication Status: Online-Only REFERENCE 4 (bases 1 to 1287) AUTHORS Yu,M., Smolen,G.A., Zhang,J., Wittner,B., Schott,B.J., Brachtel,E., Ramaswamy,S., Maheswaran,S. and Haber,D.A. TITLE A developmentally regulated inducer of EMT, LBX1, contributes to breast cancer progression JOURNAL Genes Dev. 23 (15), 1737-1742 (2009) PUBMED 19651985 REMARK GeneRIF: Ladybird homeobox 1 (LBX1), a developmentally regulated homeobox gene, directs expression of the known EMT inducers ZEB1, ZEB2, Snail1, and transforming growth factor beta2 (TGFB2). REFERENCE 5 (bases 1 to 1287) AUTHORS Deloukas,P., Earthrowl,M.E., Grafham,D.V., Rubenfield,M., French,L., Steward,C.A., Sims,S.K., Jones,M.C., Searle,S., Scott,C., Howe,K., Hunt,S.E., Andrews,T.D., Gilbert,J.G., Swarbreck,D., Ashurst,J.L., Taylor,A., Battles,J., Bird,C.P., Ainscough,R., Almeida,J.P., Ashwell,R.I., Ambrose,K.D., Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Bates,K., Beasley,H., Bray-Allen,S., Brown,A.J., Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Cahill,P., Camire,D., Carter,N.P., Chapman,J.C., Clark,S.Y., Clarke,G., Clee,C.M., Clegg,S., Corby,N., Coulson,A., Dhami,P., Dutta,I., Dunn,M., Faulkner,L., Frankish,A., Frankland,J.A., Garner,P., Garnett,J., Gribble,S., Griffiths,C., Grocock,R., Gustafson,E., Hammond,S., Harley,J.L., Hart,E., Heath,P.D., Ho,T.P., Hopkins,B., Horne,J., Howden,P.J., Huckle,E., Hynds,C., Johnson,C., Johnson,D., Kana,A., Kay,M., Kimberley,A.M., Kershaw,J.K., Kokkinaki,M., Laird,G.K., Lawlor,S., Lee,H.M., Leongamornlert,D.A., Laird,G., Lloyd,C., Lloyd,D.M., Loveland,J., Lovell,J., McLaren,S., McLay,K.E., McMurray,A., Mashreghi-Mohammadi,M., Matthews,L., Milne,S., Nickerson,T., Nguyen,M., Overton-Larty,E., Palmer,S.A., Pearce,A.V., Peck,A.I., Pelan,S., Phillimore,B., Porter,K., Rice,C.M., Rogosin,A., Ross,M.T., Sarafidou,T., Sehra,H.K., Shownkeen,R., Skuce,C.D., Smith,M., Standring,L., Sycamore,N., Tester,J., Thorpe,A., Torcasso,W., Tracey,A., Tromans,A., Tsolas,J., Wall,M., Walsh,J., Wang,H., Weinstock,K., West,A.P., Willey,D.L., Whitehead,S.L., Wilming,L., Wray,P.W., Young,L., Chen,Y., Lovering,R.C., Moschonas,N.K., Siebert,R., Fechtel,K., Bentley,D., Durbin,R., Hubbard,T., Doucette-Stamm,L., Beck,S., Smith,D.R. and Rogers,J. TITLE The DNA sequence and comparative analysis of human chromosome 10 JOURNAL Nature 429 (6990), 375-381 (2004) PUBMED 15164054 REFERENCE 6 (bases 1 to 1287) AUTHORS de Mollerat,X.J., Gurrieri,F., Morgan,C.T., Sangiorgi,E., Everman,D.B., Gaspari,P., Amiel,J., Bamshad,M.J., Lyle,R., Blouin,J.L., Allanson,J.E., Le Marec,B., Wilson,M., Braverman,N.E., Radhakrishna,U., Delozier-Blanchet,C., Abbott,A., Elghouzzi,V., Antonarakis,S., Stevenson,R.E., Munnich,A., Neri,G. and Schwartz,C.E. TITLE A genomic rearrangement resulting in a tandem duplication is associated with split hand-split foot malformation 3 (SHFM3) at 10q24 JOURNAL Hum. Mol. Genet. 12 (16), 1959-1971 (2003) PUBMED 12913067 REFERENCE 7 (bases 1 to 1287) AUTHORS Kozmik,Z., Holland,L.Z., Schubert,M., Lacalli,T.C., Kreslova,J., Vlcek,C. and Holland,N.D. TITLE Characterization of Amphioxus AmphiVent, an evolutionarily conserved marker for chordate ventral mesoderm JOURNAL Genesis 29 (4), 172-179 (2001) PUBMED 11309850 REFERENCE 8 (bases 1 to 1287) AUTHORS Jagla,K., Dolle,P., Mattei,M.G., Jagla,T., Schuhbaur,B., Dretzen,G., Bellard,F. and Bellard,M. TITLE Mouse Lbx1 and human LBX1 define a novel mammalian homeobox gene family related to the Drosophila lady bird genes JOURNAL Mech. Dev. 53 (3), 345-356 (1995) PUBMED 8645601 REFERENCE 9 (bases 1 to 1287) AUTHORS Moretti,P., Simmons,P., Thomas,P., Haylock,D., Rathjen,P., Vadas,M. and D'Andrea,R. TITLE Identification of homeobox genes expressed in human haemopoietic progenitor cells JOURNAL Gene 144 (2), 213-219 (1994) PUBMED 7518789 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL135794.19 and BC069156.1. This sequence is a reference standard in the RefSeqGene project. On May 5, 2005 this sequence version replaced gi:11184237. Summary: This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. [provided by RefSeq, Jul 2008]. ##Evidence-Data-START## Transcript exon combination :: BC069156.1, BC136321.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025099 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: full length. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-409 AL135794.19 83191-83599 c 410-1287 BC069156.1 411-1288 FEATURES Location/Qualifiers source 1..1287 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="10" /map="10q24" gene 1..1287 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="ladybird homeobox 1" /db_xref="GeneID:10660" /db_xref="HGNC:16960" /db_xref="MIM:604255" exon 1..470 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /inference="alignment:Splign:1.39.8" STS 29..1176 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /db_xref="UniSTS:491162" STS 128..1038 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /db_xref="UniSTS:482114" CDS 146..991 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="lady bird-like homeobox; transcription factor similar to D. melanogaster homeodomain protein lady bird late; ladybird homeobox protein homolog 1; ladybird homeobox homolog 1" /codon_start=1 /product="transcription factor LBX1" /protein_id="NP_006553.2" /db_xref="GI:63054872" /db_xref="CCDS:CCDS31270.1" /db_xref="GeneID:10660" /db_xref="HGNC:16960" /db_xref="MIM:604255" /translation="
MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD
" misc_feature 521..691 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:28970" misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:28970" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:28970" variation 373 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /replace="c" /replace="t" /db_xref="dbSNP:941909" exon 471..1285 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /inference="alignment:Splign:1.39.8" polyA_site 1285 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /experiment="experimental evidence, no additional details recorded" ORIGIN
ggccccgcgcccggcccgcgccctgcccagtgcggcctcctttccacccgccgctgcctgcccgcgccgtccggcgcccgagctgcccgcgggctgggtccccgcggcccgagccgccccggccgggaccccgaacaaggccgagatgacttccaaggaggacggcaaggcggcgccgggggaggagcggcggcgcagcccgctggaccacctgcctccgcctgccaactccaacaagccactgacgccgttcagcatcgaggacatcctcaacaagccgtctgtgcggagaagttactcgctgtgcggggcggcgcacctgctggccgccgcggacaagcacgcgcagggcggcttgcccctggcgggccgcgcgctgctctcgcagacctcgccgctgtgcgcgctggaggagctcgccagcaagacgtttaaggggctggaggtcagcgttctgcaggcagccgaaggccgcgacggtatgaccatctttgggcagcggcagacccctaagaagcggcgaaagtcgcgcacggccttcaccaaccaccagatctatgaattggaaaagcgctttctataccagaagtacctgtcccccgccgatcgcgaccaaatcgcgcagcagctgggcctcaccaacgcgcaagtcatcacctggttccagaatcggcgcgctaagctcaagcgggacctggaggagatgaaggccgacgtagagtccgccaagaaactgggccccagcgggcagatggacatcgtggcgctggccgaactcgagcagaactcggaggccacagccggcggtggcggcggctgcggcagggccaagtcgaggcccggctctccggtcctccccccaggcgccccgaaggccccgggcgctggcgccctgcagctctcgcctgcctctccgctcacggaccagccggccagcagccaggactgctcggaggacgaggaagacgaagagatcgacgtggacgattgagcggcgccccgggtcttccgccgccctgggctcctagcgctcgaaagcccaacgcctcccggaccggaccgccgaggggagctgggacctcctctgccaactcccgcctcctcccctgtccccggccccggactcggctcctggcagccgcctcttccctctcgaagcaataaacccaggctggccggccgggccggccgccaccagcggcctccgccgccccggaagccctcgccgtgcaattctgtatggcttctatataaatatttaaacctatatagcgggttcttcccaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:10660 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA GeneID:10660 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA GeneID:10660 -> Biological process: GO:0001947 [heart looping] evidence: IEA GeneID:10660 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA GeneID:10660 -> Biological process: GO:0007517 [muscle organ development] evidence: IEA GeneID:10660 -> Biological process: GO:0008285 [negative regulation of cell proliferation] evidence: IEA GeneID:10660 -> Biological process: GO:0009653 [anatomical structure morphogenesis] evidence: TAS GeneID:10660 -> Biological process: GO:0021920 [regulation of transcription from RNA polymerase II promoter involved in spinal cord association neuron specification] evidence: IEA GeneID:10660 -> Biological process: GO:0045665 [negative regulation of neuron differentiation] evidence: IEA GeneID:10660 -> Biological process: GO:0048664 [neuron fate determination] evidence: IEA GeneID:10660 -> Cellular component: GO:0005667 [transcription factor complex] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.