2024-03-29 06:56:13, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_006519 774 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens dynein, light chain, Tctex-type 1 (DYNLT1), mRNA. ACCESSION NM_006519 VERSION NM_006519.2 GI:295842198 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 774) AUTHORS Palmer,K.J., MacCarthy-Morrogh,L., Smyllie,N. and Stephens,D.J. TITLE A role for Tctex-1 (DYNLT1) in controlling primary cilium length JOURNAL Eur. J. Cell Biol. 90 (10), 865-871 (2011) PUBMED 21700358 REMARK GeneRIF: A role for Tctex-1 (DYNLT1) in controlling primary cilium length REFERENCE 2 (bases 1 to 774) AUTHORS Brault,J.B., Kudelko,M., Vidalain,P.O., Tangy,F., Despres,P. and Pardigon,N. TITLE The interaction of flavivirus M protein with light chain Tctex-1 of human dynein plays a role in late stages of virus replication JOURNAL Virology 417 (2), 369-378 (2011) PUBMED 21767858 REMARK GeneRIF: These data show that Tctex-1 may play a role in late stages of viral replication through its interaction with the flavivirus membrane protein. REFERENCE 3 (bases 1 to 774) AUTHORS Ochiai,K., Watanabe,M., Ueki,H., Huang,P., Fujii,Y., Nasu,Y., Noguchi,H., Hirata,T., Sakaguchi,M., Huh,N.H., Kashiwakura,Y., Kaku,H. and Kumon,H. TITLE Tumor suppressor REIC/Dkk-3 interacts with the dynein light chain, Tctex-1 JOURNAL Biochem. Biophys. Res. Commun. 412 (2), 391-395 (2011) PUBMED 21835165 REMARK GeneRIF: A link between REIC/Dkk- 3 and Tctex-1 may therefore be of significance for understanding the molecular functions of the proteins in ER stress signaling and the intracellular dynein motor dynamics, respectively. REFERENCE 4 (bases 1 to 774) AUTHORS Fang,Y.D., Xu,X., Dang,Y.M., Zhang,Y.M., Zhang,J.P., Hu,J.Y., Zhang,Q., Dai,X., Teng,M., Zhang,D.X. and Huang,Y.S. TITLE MAP4 mechanism that stabilizes mitochondrial permeability transition in hypoxia: microtubule enhancement and DYNLT1 interaction with VDAC1 JOURNAL PLoS ONE 6 (12), E28052 (2011) PUBMED 22164227 REMARK GeneRIF: there are two possible mechanisms triggered by MAP4: stabilization of MT networks; DYNLT1 modulation, which is connected with VDAC1, and inhibition of hypoxia-induced mitochondrial permeabilization REFERENCE 5 (bases 1 to 774) AUTHORS Duguay,D., Belanger-Nelson,E., Mongrain,V., Beben,A., Khatchadourian,A. and Cermakian,N. TITLE Dynein light chain Tctex-type 1 modulates orexin signaling through its interaction with orexin 1 receptor JOURNAL PLoS ONE 6 (10), E26430 (2011) PUBMED 22028875 REMARK GeneRIF: Dynlt1 modulates orexin signaling by regulating OX1R REFERENCE 6 (bases 1 to 774) AUTHORS Mueller,S., Cao,X., Welker,R. and Wimmer,E. TITLE Interaction of the poliovirus receptor CD155 with the dynein light chain Tctex-1 and its implication for poliovirus pathogenesis JOURNAL J. Biol. Chem. 277 (10), 7897-7904 (2002) PUBMED 11751937 REMARK GeneRIF: Association with Tctex-1 and, hence, with the dynein motor complex may offer an explanation for how poliovirus hijacks the cellular transport machinery to retrogradely ascend along the axon to the neuronal cell body. REFERENCE 7 (bases 1 to 774) AUTHORS Strovel,E.T., Wu,D. and Sussman,D.J. TITLE Protein phosphatase 2Calpha dephosphorylates axin and activates LEF-1-dependent transcription JOURNAL J. Biol. Chem. 275 (4), 2399-2403 (2000) PUBMED 10644691 REFERENCE 8 (bases 1 to 774) AUTHORS Nagano,F., Orita,S., Sasaki,T., Naito,A., Sakaguchi,G., Maeda,M., Watanabe,T., Kominami,E., Uchiyama,Y. and Takai,Y. TITLE Interaction of Doc2 with tctex-1, a light chain of cytoplasmic dynein. Implication in dynein-dependent vesicle transport JOURNAL J. Biol. Chem. 273 (46), 30065-30068 (1998) PUBMED 9804756 REFERENCE 9 (bases 1 to 774) AUTHORS King,S.M., Dillman,J.F. III, Benashski,S.E., Lye,R.J., Patel-King,R.S. and Pfister,K.K. TITLE The mouse t-complex-encoded protein Tctex-1 is a light chain of brain cytoplasmic dynein JOURNAL J. Biol. Chem. 271 (50), 32281-32287 (1996) PUBMED 8943288 REFERENCE 10 (bases 1 to 774) AUTHORS Watanabe,T.K., Fujiwara,T., Shimizu,F., Okuno,S., Suzuki,M., Takahashi,E., Nakamura,Y. and Hirai,Y. TITLE Cloning, expression, and mapping of TCTEL1, a putative human homologue of murine Tcte1, to 6q JOURNAL Cytogenet. Cell Genet. 73 (1-2), 153-156 (1996) PUBMED 8646886 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL589931.14, D50663.1 and BU675683.1. On May 7, 2010 this sequence version replaced gi:5730084. Summary: Cytoplasmic dynein is the major motor protein complex responsible for minus-end, microtubule-based motile processes. Each dynein complex consists of 2 heavy chains that have ATPase and motor activities, plus a group of accessory polypeptides. TCTEX1 is a dynein light chain involved in cargo binding (Chuang et al., 2005 [PubMed 15992542]).[supplied by OMIM, Mar 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BG035722.1, BG703409.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-52 AL589931.14 7964-8015 c 53-756 D50663.1 1-704 757-774 BU675683.1 1-18 c FEATURES Location/Qualifiers source 1..774 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6q25.2-q25.3" gene 1..774 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /note="dynein, light chain, Tctex-type 1" /db_xref="GeneID:6993" /db_xref="HGNC:11697" /db_xref="HPRD:15987" /db_xref="MIM:601554" exon 1..91 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /inference="alignment:Splign:1.39.8" misc_feature 5..7 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /note="upstream in-frame stop codon" CDS 65..406 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /note="t-complex-associated-testis-expressed 1-like 1; T-complex testis-specific protein 1 homolog" /codon_start=1 /product="dynein light chain Tctex-type 1" /protein_id="NP_006510.1" /db_xref="GI:5730085" /db_xref="CCDS:CCDS5257.1" /db_xref="GeneID:6993" /db_xref="HGNC:11697" /db_xref="HPRD:15987" /db_xref="MIM:601554" /translation="
MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI
" misc_feature 104..403 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /note="Tctex-1 family; Region: Tctex-1; pfam03645" /db_xref="CDD:202715" misc_feature 185..403 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /inference="non-experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (P63172.1); Region: Interaction with GNB1 (By similarity)" exon 92..133 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /inference="alignment:Splign:1.39.8" exon 134..257 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /inference="alignment:Splign:1.39.8" exon 258..335 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /inference="alignment:Splign:1.39.8" exon 336..759 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /inference="alignment:Splign:1.39.8" STS 476..634 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /standard_name="A005A07" /db_xref="UniSTS:5624" STS 476..634 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /standard_name="G32210" /db_xref="UniSTS:116817" variation 528 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /replace="g" /replace="t" /db_xref="dbSNP:1804639" variation 645 /gene="DYNLT1" /gene_synonym="CW-1; TCTEL1; tctex-1" /replace="c" /replace="g" /db_xref="dbSNP:1804638" ORIGIN
ggcctgagtgcgcctgcgcagtccgcgccactcagggagccggaggggacgcgccggaggaaagatggaagactaccaggctgcggaggagactgcttttgttgttgatgaagtgagcaacattgtaaaagaggctatagaaagcgcaattggtggtaacgcttatcaacacagcaaagtgaaccagtggaccacaaatgtagtagaacaaactttaagccaactcaccaagctgggaaaaccatttaaatacatcgtgacctgtgtaattatgcagaagaatggagctggattacacacagcaagttcctgcttctgggacagctctactgacgggagctgcactgtgcgatgggagaataagaccatgtactgcatcgtcagtgccttcggactgtctatttgacctgcagtccagcctatggcctttctccttttgtctctagttcatcctctaaccaccagccatgaattcagtgaactcttttctcattctctttgttttgtggcactttcacaatgtagaggaaaaaaccaaatgaccgcactgtgatgtgaatggcaccgaagtcagatgagtatccctgtaggtcacctgcagcctgcgttgccacttgtcttaactctgaatatttcatttcaaaggtgctaaaatctgaaatctgctagtgtgaaacttgctctactctctgaaatgattcaaatacactaattttccatactttatacttttgttagaataaattattcaaatctaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:6993 -> Molecular function: GO:0003774 [motor activity] evidence: IEA GeneID:6993 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:6993 -> Molecular function: GO:0042802 [identical protein binding] evidence: IPI GeneID:6993 -> Biological process: GO:0000132 [establishment of mitotic spindle orientation] evidence: ISS GeneID:6993 -> Biological process: GO:0007067 [mitosis] evidence: IEA GeneID:6993 -> Biological process: GO:0008277 [regulation of G-protein coupled receptor protein signaling pathway] evidence: ISS GeneID:6993 -> Biological process: GO:0019060 [intracellular transport of viral proteins in host cell] evidence: IMP GeneID:6993 -> Biological process: GO:0032314 [regulation of Rac GTPase activity] evidence: IEA GeneID:6993 -> Biological process: GO:0046718 [viral entry into host cell] evidence: IEA GeneID:6993 -> Biological process: GO:0048812 [neuron projection morphogenesis] evidence: IEA GeneID:6993 -> Biological process: GO:0050768 [negative regulation of neurogenesis] evidence: ISS GeneID:6993 -> Biological process: GO:0051301 [cell division] evidence: IEA GeneID:6993 -> Biological process: GO:0051493 [regulation of cytoskeleton organization] evidence: IEA GeneID:6993 -> Biological process: GO:0075521 [microtubule-dependent intracellular transport of viral material to nucleus] evidence: IEA GeneID:6993 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA GeneID:6993 -> Cellular component: GO:0005819 [spindle] evidence: IEA GeneID:6993 -> Cellular component: GO:0005868 [cytoplasmic dynein complex] evidence: ISS GeneID:6993 -> Cellular component: GO:0005874 [microtubule] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.