GGRNA Home | Help | Advanced search

2020-10-30 19:32:34, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_006258               6644 bp    mRNA    linear   PRI 16-JUN-2013
DEFINITION  Homo sapiens protein kinase, cGMP-dependent, type I (PRKG1),
            transcript variant 2, mRNA.
ACCESSION   NM_006258
VERSION     NM_006258.3  GI:345842461
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 6644)
  AUTHORS   Lauc,G., Huffman,J.E., Pucic,M., Zgaga,L., Adamczyk,B., Muzinic,A.,
            Novokmet,M., Polasek,O., Gornik,O., Kristic,J., Keser,T.,
            Vitart,V., Scheijen,B., Uh,H.W., Molokhia,M., Patrick,A.L.,
            McKeigue,P., Kolcic,I., Lukic,I.K., Swann,O., van Leeuwen,F.N.,
            Ruhaak,L.R., Houwing-Duistermaat,J.J., Slagboom,P.E., Beekman,M.,
            de Craen,A.J., Deelder,A.M., Zeng,Q., Wang,W., Hastie,N.D.,
            Gyllensten,U., Wilson,J.F., Wuhrer,M., Wright,A.F., Rudd,P.M.,
            Hayward,C., Aulchenko,Y., Campbell,H. and Rudan,I.
  TITLE     Loci associated with N-glycosylation of human immunoglobulin G show
            pleiotropy with autoimmune diseases and haematological cancers
  JOURNAL   PLoS Genet. 9 (1), E1003225 (2013)
   PUBMED   23382691
REFERENCE   2  (bases 1 to 6644)
  AUTHORS   Karami-Tehrani,F., Fallahian,F. and Atri,M.
  TITLE     Expression of cGMP-dependent protein kinase, PKGIalpha, PKGIbeta,
            and PKGII in malignant and benign breast tumors
  JOURNAL   Tumour Biol. 33 (6), 1927-1932 (2012)
   PUBMED   22791569
  REMARK    GeneRIF: Downregulation of PKG1 was associated with malignant and
            benign breast tumors.
REFERENCE   3  (bases 1 to 6644)
  AUTHORS   Kato,M., Blanton,R., Wang,G.R., Judson,T.J., Abe,Y., Myoishi,M.,
            Karas,R.H. and Mendelsohn,M.E.
  TITLE     Direct binding and regulation of RhoA protein by cyclic
            GMP-dependent protein kinase Ialpha
  JOURNAL   J. Biol. Chem. 287 (49), 41342-41351 (2012)
   PUBMED   23066013
  REMARK    GeneRIF: RhoA is a PKGIalpha target and direct binding of activated
            PKGIalpha to RhoA is central to cGMP-mediated inhibition of the
            VSMC Rho kinase contractile pathway
REFERENCE   4  (bases 1 to 6644)
  AUTHORS   van Heerebeek,L., Hamdani,N., Falcao-Pires,I., Leite-Moreira,A.F.,
            Begieneman,M.P., Bronzwaer,J.G., van der Velden,J., Stienen,G.J.,
            Laarman,G.J., Somsen,A., Verheugt,F.W., Niessen,H.W. and
            Paulus,W.J.
  TITLE     Low myocardial protein kinase G activity in heart failure with
            preserved ejection fraction
  JOURNAL   Circulation 126 (7), 830-839 (2012)
   PUBMED   22806632
  REMARK    GeneRIF: Low myocardial PKG activity in heart failure with
            preserved ejection fraction was associated with raised
            cardiomyocyte F(passive) and was related to increased myocardial
            nitrosative/oxidative stress.
REFERENCE   5  (bases 1 to 6644)
  AUTHORS   Comuzzie,A.G., Cole,S.A., Laston,S.L., Voruganti,V.S., Haack,K.,
            Gibbs,R.A. and Butte,N.F.
  TITLE     Novel genetic loci identified for the pathophysiology of childhood
            obesity in the Hispanic population
  JOURNAL   PLoS ONE 7 (12), E51954 (2012)
   PUBMED   23251661
REFERENCE   6  (bases 1 to 6644)
  AUTHORS   Pohler,D., Butt,E., Meissner,J., Muller,S., Lohse,M., Walter,U.,
            Lohmann,S.M. and Jarchau,T.
  TITLE     Expression, purification, and characterization of the
            cGMP-dependent protein kinases I beta and II using the baculovirus
            system
  JOURNAL   FEBS Lett. 374 (3), 419-425 (1995)
   PUBMED   7589584
REFERENCE   7  (bases 1 to 6644)
  AUTHORS   Komalavilas,P. and Lincoln,T.M.
  TITLE     Phosphorylation of the inositol 1,4,5-trisphosphate receptor by
            cyclic GMP-dependent protein kinase
  JOURNAL   J. Biol. Chem. 269 (12), 8701-8707 (1994)
   PUBMED   8132598
REFERENCE   8  (bases 1 to 6644)
  AUTHORS   Picciotto,M.R., Cohn,J.A., Bertuzzi,G., Greengard,P. and Nairn,A.C.
  TITLE     Phosphorylation of the cystic fibrosis transmembrane conductance
            regulator
  JOURNAL   J. Biol. Chem. 267 (18), 12742-12752 (1992)
   PUBMED   1377674
REFERENCE   9  (bases 1 to 6644)
  AUTHORS   Orstavik,S., Sandberg,M., Berube,D., Natarajan,V., Simard,J.,
            Walter,U., Gagne,R., Hansson,V. and Jahnsen,T.
  TITLE     Localization of the human gene for the type I cyclic GMP-dependent
            protein kinase to chromosome 10
  JOURNAL   Cytogenet. Cell Genet. 59 (4), 270-273 (1992)
   PUBMED   1544322
REFERENCE   10 (bases 1 to 6644)
  AUTHORS   Sandberg,M., Natarajan,V., Ronander,I., Kalderon,D., Walter,U.,
            Lohmann,S.M. and Jahnsen,T.
  TITLE     Molecular cloning and predicted full-length amino acid sequence of
            the type I beta isozyme of cGMP-dependent protein kinase from human
            placenta. Tissue distribution and developmental changes in rat
  JOURNAL   FEBS Lett. 255 (2), 321-329 (1989)
   PUBMED   2792381
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DA150150.1, BC127090.1,
            AL599933.1, BX952280.1, DB138350.1, DA915933.1, DA646702.1,
            CD723759.1, BX097700.1 and BQ445850.1.
            On Sep 9, 2011 this sequence version replaced gi:148612883.
            
            Summary: Mammals have three different isoforms of cyclic
            GMP-dependent protein kinase (Ialpha, Ibeta, and II). These PRKG
            isoforms act as key mediators of the nitric oxide/cGMP signaling
            pathway and are important components of many signal transduction
            processes in diverse cell types. This PRKG1 gene on human
            chromosome 10 encodes the soluble Ialpha and Ibeta isoforms of PRKG
            by alternative transcript splicing. A separate gene on human
            chromosome 4, PRKG2, encodes the membrane-bound PRKG isoform II.
            The PRKG1 proteins play a central role in regulating cardiovascular
            and neuronal functions in addition to relaxing smooth muscle tone,
            preventing platelet aggregation, and modulating cell growth. This
            gene is most strongly expressed in all types of smooth muscle,
            platelets, cerebellar Purkinje cells, hippocampal neurons, and the
            lateral amygdala. Isoforms Ialpha and Ibeta have identical
            cGMP-binding and catalytic domains but differ in their
            leucine/isoleucine zipper and autoinhibitory sequences and
            therefore differ in their dimerization substrates and kinase enzyme
            activity. [provided by RefSeq, Sep 2011].
            
            Transcript Variant: This variant (2) uses an alternate exon at its
            5' end which result in the use of a distinct translation initiation
            site, compared to variant 1. This difference results in an isoform
            (2; also known as beta or 1beta) with a longer and distinct
            N-terminus, compared to isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: Y07512.1, BC127090.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084, ERS025088 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-59                DA150150.1         1-59
            60-3105             BC127090.1         1-3046
            3106-3414           AL599933.1         240-548
            3415-3961           BX952280.1         19-565
            3962-4485           DB138350.1         15-538
            4486-4886           DA915933.1         121-521
            4887-5443           DA646702.1         79-635
            5444-5692           CD723759.1         370-618
            5693-5936           BX097700.1         186-429
            5937-6644           BQ445850.1         1-708               c
FEATURES             Location/Qualifiers
     source          1..6644
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="10"
                     /map="10q11.2"
     gene            1..6644
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="protein kinase, cGMP-dependent, type I"
                     /db_xref="GeneID:5592"
                     /db_xref="HGNC:9414"
                     /db_xref="HPRD:08910"
                     /db_xref="MIM:176894"
     exon            1..428
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       21
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:193255334"
     misc_feature    46..48
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="upstream in-frame stop codon"
     variation       86
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374816419"
     variation       87
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:41274080"
     variation       88
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199796018"
     variation       89
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201816168"
     variation       106
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200657516"
     CDS             118..2178
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /EC_number="2.7.11.12"
                     /note="isoform 2 is encoded by transcript variant 2;
                     cGMP-dependent protein kinase 1; protein kinase,
                     cGMP-dependent, regulatory, type I, beta"
                     /codon_start=1
                     /product="cGMP-dependent protein kinase 1 isoform 2"
                     /protein_id="NP_006249.1"
                     /db_xref="GI:10835242"
                     /db_xref="CCDS:CCDS7244.1"
                     /db_xref="GeneID:5592"
                     /db_xref="HGNC:9414"
                     /db_xref="HPRD:08910"
                     /db_xref="MIM:176894"
                     /translation="
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF
"
     misc_feature    127..282
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="Dimerization/Docking domain of Cyclic GMP-dependent
                     Protein Kinase I beta; Region: DD_cGKI-beta; cd12086"
                     /db_xref="CDD:213375"
     misc_feature    order(127..129,136..141,145..150,157..159,166..171,
                     178..183,190..192,199..204,208..213,220..225,229..234,
                     241..246,250..255,262..267)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:213375"
     misc_feature    order(193..198,202..204,208..210)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="putative GKAP docking site [polypeptide binding];
                     other site"
                     /db_xref="CDD:213375"
     misc_feature    286..288
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="phosphorylation site"
                     /db_xref="HPRD:01498"
     misc_feature    463..>915
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:31008"
     misc_feature    469..798
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:28920"
     misc_feature    order(661..666,691..699)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:28920"
     misc_feature    order(757..765,775..783)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:28920"
     misc_feature    826..1140
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:28920"
     misc_feature    order(1033..1038,1063..1071)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:28920"
     misc_feature    1129..1137
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:28920"
     misc_feature    1240..2019
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:197582"
     misc_feature    1258..2040
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="Catalytic domain of the Protein Serine/Threonine
                     Kinase, cGMP-dependent protein kinase; Region:
                     STKc_cGK_PKG; cd05572"
                     /db_xref="CDD:173663"
     misc_feature    order(1258..1272,1282..1284,1324..1326,1330..1332,
                     1426..1428,1474..1479,1483..1485,1495..1497,1501..1503,
                     1612..1614,1618..1620,1624..1629,1633..1635,1663..1668,
                     1675..1677,1714..1731,1810..1812,1828..1830,1837..1839)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="active site"
                     /db_xref="CDD:173663"
     misc_feature    order(1258..1272,1282..1284,1324..1326,1330..1332,
                     1426..1428,1477..1485,1495..1497,1612..1614,1618..1620,
                     1624..1629,1633..1635,1663..1668)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173663"
     misc_feature    order(1270..1272,1495..1497,1501..1503,1612..1614,
                     1618..1620,1624..1626,1675..1677,1714..1731,1810..1812,
                     1828..1830,1837..1839)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173663"
     misc_feature    order(1663..1695,1705..1731)
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173663"
     misc_feature    2023..>2106
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /note="Extension to Ser/Thr-type protein kinases; Region:
                     S_TK_X; smart00133"
                     /db_xref="CDD:197531"
     variation       132
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:148780812"
     variation       180
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:143805509"
     variation       230
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:370238413"
     variation       240
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:146681875"
     variation       249
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139227021"
     variation       281
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:201334891"
     variation       357
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:143971889"
     variation       397
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183672685"
     variation       399
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140072060"
     variation       424
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:201361942"
     exon            429..595
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       438
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201033058"
     variation       457
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:183697950"
     variation       492
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:111805858"
     variation       512
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140871298"
     variation       516
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56398862"
     variation       525
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:55806342"
     variation       543
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:55754654"
     variation       567
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368286950"
     variation       573
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370592925"
     exon            596..709
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       639
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369697050"
     variation       659
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141293448"
     variation       663
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73336216"
     variation       695
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202137835"
     variation       699
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370511935"
     variation       702
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:139104275"
     exon            710..815
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       759
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370640208"
     variation       762
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:374706235"
     variation       792
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142166726"
     variation       805
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:67743249"
     exon            816..879
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       816
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200818051"
     variation       817
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:368571406"
     variation       823
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:67010743"
     exon            880..957
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       895
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368465530"
     variation       907
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:56082459"
     variation       927
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:151055252"
     variation       956
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376134488"
     exon            958..1052
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       961
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:142586643"
     variation       962
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:34997494"
     variation       984
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150189667"
     variation       1005
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:113994747"
     variation       1010
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:140716870"
     variation       1023
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145917628"
     exon            1053..1118
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1056
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201105457"
     variation       1097
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:138485549"
     variation       1106
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:112529278"
     exon            1119..1193
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1125
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:56047641"
     variation       1134
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:187636159"
     variation       1143
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374834674"
     variation       1184
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:144345072"
     variation       1188
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:75650199"
     exon            1194..1290
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1197
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141218982"
     variation       1208
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369811301"
     variation       1209
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:373675576"
     exon            1291..1430
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1302
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140238138"
     variation       1345
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:377519440"
     variation       1346
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:201147665"
     variation       1381
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147351459"
     variation       1407
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:139494883"
     variation       1416
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145035655"
     variation       1417
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371044753"
     variation       1424
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:375281027"
     exon            1431..1520
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1432
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142314590"
     variation       1471
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:11001408"
     exon            1521..1662
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1540
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140630065"
     variation       1545
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374020671"
     variation       1577
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201693342"
     variation       1583
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:149710600"
     variation       1613
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78669561"
     variation       1614
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:74484055"
     variation       1615
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:78350819"
     variation       1622
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376854572"
     variation       1642
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:139646798"
     variation       1653
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149159224"
     exon            1663..1826
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1693
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:74905373"
     variation       1728
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370755321"
     variation       1731
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:368573664"
     variation       1761
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200771178"
     variation       1779
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:374202731"
     variation       1792
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:376012509"
     exon            1827..1949
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1827
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200610874"
     variation       1842
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:75921640"
     variation       1912
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:199639042"
     exon            1950..2012
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       1984
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201720423"
     exon            2013..2079
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     exon            2080..6628
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /inference="alignment:Splign:1.39.8"
     variation       2099
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:370924713"
     variation       2130
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373962932"
     variation       2131
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:142375882"
     variation       2158
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370223766"
     variation       2160
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:146785168"
     variation       2162
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201962623"
     variation       2169
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374752370"
     variation       2228
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:111412349"
     variation       2328
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:375617859"
     variation       2335
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1881597"
     variation       2431..2432
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:5784918"
     variation       2431
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199525981"
     variation       2432..2433
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:35902208"
     variation       2500
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369811640"
     variation       2532
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:149529640"
     variation       2574
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184962324"
     variation       2579
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:7475230"
     variation       2615
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:114629806"
     variation       2645
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147223441"
     variation       2698
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189859435"
     variation       2736
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:374027360"
     variation       2825
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:60880574"
     variation       2898..2899
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:202187901"
     variation       2972
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:181058655"
     variation       3003
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:201270301"
     variation       3063
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:144232368"
     variation       3084
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:147797170"
     variation       3089
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:183674759"
     variation       3141
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148439915"
     STS             3159..3864
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /standard_name="PRKG1__5582"
                     /db_xref="UniSTS:463829"
     variation       3270
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:142564633"
     STS             3501..3601
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /standard_name="GDB:193872"
                     /db_xref="UniSTS:155780"
     STS             3519..3756
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /standard_name="RH70960"
                     /db_xref="UniSTS:48485"
     variation       3546
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:188048911"
     variation       3610
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:181979258"
     variation       3613..3614
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace=""
                     /replace="ta"
                     /db_xref="dbSNP:56909757"
     variation       3614
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:187337608"
     variation       3628
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:191738229"
     variation       3670
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151292915"
     variation       3680
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:80233992"
     variation       3698
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:145883258"
     variation       3783
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:181838177"
     variation       3839
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:72789108"
     variation       3896
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:12267483"
     variation       3955
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:77557186"
     variation       4030
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:186539177"
     variation       4077
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:146643393"
     variation       4394
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:190274220"
     variation       4466
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141212596"
     variation       4479
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:12255069"
     variation       4544
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76189077"
     variation       4599
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:145021796"
     variation       4622
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:138725303"
     variation       4667
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:116671618"
     variation       4701
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:186874046"
     variation       4830..4831
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:376755123"
     variation       4871..4872
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:34995781"
     variation       4903
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:189757772"
     variation       5032
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:374707308"
     variation       5043
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:376783068"
     variation       5065
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149365450"
     variation       5072
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:372291158"
     variation       5080
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:368325228"
     variation       5151
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:73348750"
     variation       5158
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:184038298"
     variation       5215
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374952525"
     variation       5649
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:371442841"
     variation       5758
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:189043594"
     variation       5868
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:193008761"
     variation       5965
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:185324700"
     variation       6015
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:3812673"
     variation       6144
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:370162449"
     variation       6151
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:187261557"
     variation       6158
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:191778597"
     variation       6171
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:148025627"
     variation       6243
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:13499"
     variation       6349
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:76022725"
     variation       6368
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:147213572"
     variation       6498
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:369670812"
     variation       6529
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:75002984"
     polyA_signal    6605..6610
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
     polyA_site      6628
                     /gene="PRKG1"
                     /gene_synonym="1; cGK; cGK 1; cGK1; cGKI; cGKI-alpha;
                     cGKI-BETA; PKG; PRKG1B; PRKGR1B"
ORIGIN      
aggaagctttggcactcgggaggcagcggcgactttggggaaagttgatcggagaggggaggaagcctcaagacgcggagcagcggcaggaaggagcccccggcagcccggaggagcatgggcaccttgcgggatttacagtacgcgctccaggagaagatcgaggagctgaggcagcgggatgctctcatcgacgagctggagctggagttggatcagaaggacgaactgatccagaagctgcagaacgagctggacaagtaccgctcggtgatccgaccagccacccagcaggcgcagaagcagagcgcgagcaccttgcagggcgagccgcgcaccaagcggcaggcgatctccgccgagcccaccgccttcgacatccaggatctcagccatgtgaccctgcccttctaccccaagagcccacagtccaaggatcttataaaggaagctatccttgacaatgactttatgaagaacttggagctgtcgcagatccaggagattgtggattgtatgtacccggtggagtatggcaaggacagttgcatcatcaaagaaggagacgtggggtcactggtgtatgtcatggaagatggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatgggtccaggaaaagtgtttggggaattggctattctttacaactgtacccggacagcgaccgtcaagactcttgtaaatgtaaaactctgggccattgatcgacaatgttttcaaacaataatgatgaggacaggactcatcaagcataccgagtatatggaatttttaaaaagcgttccaacattccagagccttcctgaagagatcctcagcaagcttgctgatgtccttgaagagacccactatgaaaatggagaatatattatcaggcaaggtgcaagaggggacaccttctttatcatcagcaaaggaacggtaaatgtcactcgtgaagactcaccgagtgaagacccagtctttcttagaactttaggaaaaggagactggtttggagagaaagccttgcagggggaagatgtgagaacagcaaacgtaattgctgcagaagctgtaacctgccttgtgattgacagagactcttttaaacatttgattggagggctggatgatgtttctaataaagcatatgaagatgcagaagctaaagcaaaatatgaagctgaagcggctttcttcgccaacctgaagctgtctgatttcaacatcattgatacccttggagttggaggtttcggacgagtagaactggtccagttgaaaagtgaagaatccaaaacgtttgcaatgaagattctcaagaaacgtcacattgtggacacaagacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattccgatttcatagtgagactgtacagaacatttaaggacagcaaatatttgtatatgttgatggaagcttgtctaggtggagagctctggaccattctcagggatagaggttcgtttgaagattctacaaccagattttacacagcatgtgtggtagaagcttttgcctatctgcattccaaaggaatcatttacagggacctcaagccagaaaatctcatcctagatcaccgaggttatgccaaactggttgattttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtgggactccagagtatgtagccccagagatcatcctgaacaaaggccatgacatttcagccgactactggtcactgggaatcctaatgtatgaactcctgactggcagcccacctttctcaggcccagatcctatgaaaacctataacatcatattgagggggattgacatgatagaatttccaaagaagattgccaaaaatgctgctaatttaattaaaaaactatgcagggacaatccatcagaaagattagggaatttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgagggctttaactgggaaggcttaagaaaaggtaccttgacacctcctataataccaagtgttgcatcacccacagacacaagtaattttgacagtttccctgaggacaacgatgaaccaccacctgatgacaactcaggatgggatatagacttctaatgtatttctcttacctgcttctgccttgctgaagacagctttttctgagacacagctgccagcaaacctgagggaaagagagaagattagtgctcggggtcaccatgatgcctttgatcgatgctgctccagtaactacagtggcattaggacttaccgcttagatgacaatagtgctctttacatgttttctgtttgaacctaaaatagcagttgacatggtggtcctgaagcaaagcctttcaccagtaaaagatgttttctattgttgcaatgaccttgctttgctctgattataatttgaaagactgtaggaaacacttcaatgtagtataagagtctgtaccttgctggaatattcaagaagatgaaagaataatatattgggtacaatagattactatggtacagaaactgggctattccctttcttcaagtgaaggctgtgggatctattactgcaggccggtgtatataccatacaaaagaggaccacacatctgttggtcacagagttcatgtcacaccagtgctagaagtttcatgattttatttcccagcagtgctgatgacaagactgaatgttaccttttctttctgacagattttaaaaattgatatgataaaagcacaactgctatagattctgctgagacctctcatagtaggtatatatgagttttcacagaagactgaaaaataatgcatgatatttgtttgttttttttgataaattggcatgacagagtggggaaaaaaagcaattcacaaaaccatttcatattttttaaaatattgtgcttaaagatggtcctggaagtaaatgactagcagccaattggttttacttaacataccctcaaactgaggcttaaagtattcccttttataaaaataaatgcttggggtagggtggagtggggagggattaaaacccatccaaaaaataaataaaaactatataggtgctatgtatatctttcatctgtaaatgtcagtgtctgaacagacaacacaaattcaaatcattatacgtgtagccagaaactcaagcattttcactaaagttattaaaccaaactcctgtccaatttcacttatacaacatagtcagtctagagttgagagacaaaggtaattataaacctatttgaactagcttcttgtcttaggcctgaaccaaaaaacaacaaacaaacaaaaaacaagaatgaaaaacagaaataaaagaagtagaaaagacaaagaaagaaagcccaaagtcaaagttgttaatatttacaggtttaccagatctggaacattacttatttgaggtcagagaacaaaacaagaacctggccaggtgttgattaccttttagtgaataagctgagtccatatacttgtctaactaagaaagcagtacagaggaaaacaggaacctgatttttttaaaataaattttaaataaaatagaattactacaattctgcaatttcatactacctaaaaaagactagatttgaaaatgtcaagctgatttactttattcacatggagaaaagaatccacaaattaaactgagtccttcactggcatgccagttgactattattagctgtcataagtaactcagccatttggaagcatttcctggacaaaattacattatacctgtgaagaaaaatatagaagctttcaagctgtcattctgttttggccctgtgtgaatttggtatattaaattgacgcttgctttttttttcagtagagttttctttttaatcaatcaaacgcctacatttctggaagaaaaagtccaattagatcattacaccttaactaagaaggcaaatcttataaattttgcttgaattgttcttactcaaaactaccttagaatatggtatcttatgaaaatataatattcttaaaattttggaggataaaatgaaaagggtataaacttcaattagaactttaatcctaaaatattgttattcttgtatttttggagttttccgtcccttacaatttctccaaattggtctattccccaagatatccactgttttctacagattttagaatataaaattaaacatatcaacctaaaatctagctatgaatgttatttcaagagttttatatttttaattggctttttaaaaatatgtaattccaatattatagtgaatgttcagtaacttttgttgaaagataatgtggtttaggcttgctaaagaaaggcttgctagaatactaaatttaccttgttatttggaaagagaatctgctcctataacgttttaaaaatccccaaagtcccagagattagcacttgctatggattttggaactatggttcaagtctaagacaaccaatatgaataagttcaatggagaaggaagaagtagcattcagcacaagaaactgtagattgtttctcccacttgttactgcatctttgttcatttcacccatagcattgcatttgatgtctgaagtaattaccacaaaataaaggtaaactacatcttccaagatgtaccaacagaaaacattcgtctaattttgtcaacattgaatttttaggatttaaatcttgtcttaatgaagactctagggctaaaattcatggtcagttccataaaatgcatctcactttatttctgaatttttcacaacccctctattttcttacattaaagaacatctggataagttagaatagtgccaacttgtttgatttgttatatgattttcttgttaatgtgttgagtatgggaaataagggctttctgtgtgtcttgactcacaggaaaactgaaactgccaagggaagcaacattaaaacaactgggatagattgaatacatttgaaaaaataatttctggaaaaacgctatacatgctttttatgtttatatcttctttcttattaagacatgaatcagatccatgtggcattcaaaacaaatttattttggttatattctttacaagtcataatttttacctaaaattgtggaatatgcatgtgaattacacatgtgtagtaataaactcaactattgaatttttcctgtttcatttctaaatgactgaactgatggtaaacaaatttaatgaagtcagctaccatgttgaaaataaggatattagaactgatttcatacaatagaggtgatctgtgcattatccataacaacgttttctttcactataggaccacagacaaatatttatgtaaataggtatttttgtgtgatattttgtggtacatataactttttttagtgtttcacagcattattatttcattttatttgtattgaataatgtttttaggtccaagtagacttgaattaatgtcataattgtcagtattattgaaaattatgtcaactgtactgttattcatctgtcccatagtttagaacatgacctggctatctggcattgttgcaagtgccttaaattcatggcatcctattaaaaaaacaaatttggtgttatgctgcatgacaaagacaaacacacctcaaaatgttgtcctttcttagcttgctgcgttttacagttctttctgctaacaatttataagcctttattatataatattgatgaattacagaaatgatgaagttgttctcttatttctgttaaatgtaccagagctgtgtatctgttaatgagatacagcgtcatttctgtgaaatgtataaatgtatgtgcaggtcaaattaatatatgacattctatcagtctgtatacaggtattcctgttttgctaagctgtgcagattctgtaaaaataaattagtgcagtcaagttctaacatatctcattttatagactccattgacaatggtccaaccgaaaagaaaaattggaaatgactgctaaccagacctcgttatgaaaccaatgatgaaaaagtcacttggtgcacctctcaacaaaacaggatgctttttccgagttcttgtatatgcaaatcatttacgaggcaagttttcaacagacctagaaagcaaaacattgaaagtgtgttgttagccctcctctctgcccctgaatcaacagacagagctctgggaccttggcaatgactcagaggttggggctttctgagtaaagggacatttctttaagcatcatctatcaaatttatttcaatgtatgatgtttttacaactggtcagttcttttgtattcttacagctatggttatttgattgtcctcttacaatttgttctacatgaaagagttctttgttagtcagaatgcaacaaactgtcatcaaatggtcattgaccacttgcactcttttgatgtagattaaaaactttttcataaatttacctgctttgatttgctctgtatttttcctgcagctgtaattgctgagtgcctgttgtatactttatagagttgaaataaaaaaataattacttttgaaaaaaaaaaaaaaaaaa
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:5592 -> Molecular function: GO:0004692 [cGMP-dependent protein kinase activity] evidence: IDA
            GeneID:5592 -> Molecular function: GO:0005246 [calcium channel regulator activity] evidence: IDA
            GeneID:5592 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
            GeneID:5592 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
            GeneID:5592 -> Molecular function: GO:0030553 [cGMP binding] evidence: IEA
            GeneID:5592 -> Biological process: GO:0001764 [neuron migration] evidence: IEA
            GeneID:5592 -> Biological process: GO:0006468 [protein phosphorylation] evidence: TAS
            GeneID:5592 -> Biological process: GO:0007165 [signal transduction] evidence: IEA
            GeneID:5592 -> Biological process: GO:0007596 [blood coagulation] evidence: TAS
            GeneID:5592 -> Biological process: GO:0016358 [dendrite development] evidence: IEA
            GeneID:5592 -> Biological process: GO:0030036 [actin cytoskeleton organization] evidence: TAS
            GeneID:5592 -> Biological process: GO:0030900 [forebrain development] evidence: IEA
            GeneID:5592 -> Biological process: GO:0043087 [regulation of GTPase activity] evidence: IMP
            GeneID:5592 -> Biological process: GO:0090331 [negative regulation of platelet aggregation] evidence: IMP
            GeneID:5592 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:5592 -> Cellular component: GO:0005794 [Golgi apparatus] evidence: IEA
            GeneID:5592 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
            GeneID:5592 -> Cellular component: GO:0005886 [plasma membrane] evidence: IDA
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_006249 -> EC 2.7.11.12

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.