Home |
Help |
Advanced search
2024-04-19 22:26:26, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_005805 1734 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens proteasome (prosome, macropain) 26S subunit,
non-ATPase, 14 (PSMD14), mRNA.
ACCESSION NM_005805
VERSION NM_005805.5 GI:375268695
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1734)
AUTHORS Butler,L.R., Densham,R.M., Jia,J., Garvin,A.J., Stone,H.R.,
Shah,V., Weekes,D., Festy,F., Beesley,J. and Morris,J.R.
TITLE The proteasomal de-ubiquitinating enzyme POH1 promotes the
double-strand DNA break response
JOURNAL EMBO J. 31 (19), 3918-3934 (2012)
PUBMED 22909820
REMARK GeneRIF: The data demonstrated that proteasomal POH1 is a key
de-ubiquitinating enzyme that regulates ubiquitin conjugates
generated in response to damage and that several aspects of the DNA
double-strand break response are regulated by the proteasome.
REFERENCE 2 (bases 1 to 1734)
AUTHORS Byrne,A., McLaren,R.P., Mason,P., Chai,L., Dufault,M.R., Huang,Y.,
Liang,B., Gans,J.D., Zhang,M., Carter,K., Gladysheva,T.B.,
Teicher,B.A., Biemann,H.P., Booker,M., Goldberg,M.A., Klinger,K.W.,
Lillie,J., Madden,S.L. and Jiang,Y.
TITLE Knockdown of human deubiquitinase PSMD14 induces cell cycle arrest
and senescence
JOURNAL Exp. Cell Res. 316 (2), 258-271 (2010)
PUBMED 19732767
REMARK GeneRIF: Down-regulation of PSMD14 results in decreased cell
proliferation, cell cycle arrest and senescence. A comparative
study with PSMB5, revealed that PSMB5 and PSMD14 have different
effects on cell cycle, senescence and associated molecular events.
REFERENCE 3 (bases 1 to 1734)
AUTHORS Ma,Z., Gao,X., Zhao,W., Li,Y., Li,C. and Li,C.
TITLE Relationship between expression of Pad1 homologue and multidrug
resistance of idiopathic nephrotic syndrome
JOURNAL Pediatr Int 51 (5), 732-735 (2009)
PUBMED 19419512
REMARK GeneRIF: Disorder of POH1 expression is involved in the onset of
idiopathic nephrotic syndrome (INS), and confers multidrug
resistance in children with INS
REFERENCE 4 (bases 1 to 1734)
AUTHORS Cooper,E.M., Cutcliffe,C., Kristiansen,T.Z., Pandey,A.,
Pickart,C.M. and Cohen,R.E.
TITLE K63-specific deubiquitination by two JAMM/MPN+ complexes:
BRISC-associated Brcc36 and proteasomal Poh1
JOURNAL EMBO J. 28 (6), 621-631 (2009)
PUBMED 19214193
REMARK GeneRIF: Specificity for K63-linked polyubiquitin is a common
property of the JAMM/MPN+ family of deubiquitinating enzymes.
REFERENCE 5 (bases 1 to 1734)
AUTHORS Koulich,E., Li,X. and DeMartino,G.N.
TITLE Relative structural and functional roles of multiple
deubiquitylating proteins associated with mammalian 26S proteasome
JOURNAL Mol. Biol. Cell 19 (3), 1072-1082 (2008)
PUBMED 18162577
REFERENCE 6 (bases 1 to 1734)
AUTHORS Listovsky,T., Oren,Y.S., Yudkovsky,Y., Mahbubani,H.M., Weiss,A.M.,
Lebendiker,M. and Brandeis,M.
TITLE Mammalian Cdh1/Fzr mediates its own degradation
JOURNAL EMBO J. 23 (7), 1619-1626 (2004)
PUBMED 15029244
REFERENCE 7 (bases 1 to 1734)
AUTHORS Ambroggio,X.I., Rees,D.C. and Deshaies,R.J.
TITLE JAMM: a metalloprotease-like zinc site in the proteasome and
signalosome
JOURNAL PLoS Biol. 2 (1), E2 (2004)
PUBMED 14737182
REFERENCE 8 (bases 1 to 1734)
AUTHORS Margottin-Goguet,F., Hsu,J.Y., Loktev,A., Hsieh,H.M., Reimann,J.D.
and Jackson,P.K.
TITLE Prophase destruction of Emi1 by the SCF(betaTrCP/Slimb) ubiquitin
ligase activates the anaphase promoting complex to allow
progression beyond prometaphase
JOURNAL Dev. Cell 4 (6), 813-826 (2003)
PUBMED 12791267
REFERENCE 9 (bases 1 to 1734)
AUTHORS Geley,S., Kramer,E., Gieffers,C., Gannon,J., Peters,J.M. and
Hunt,T.
TITLE Anaphase-promoting complex/cyclosome-dependent proteolysis of human
cyclin A starts at the beginning of mitosis and is not subject to
the spindle assembly checkpoint
JOURNAL J. Cell Biol. 153 (1), 137-148 (2001)
PUBMED 11285280
REFERENCE 10 (bases 1 to 1734)
AUTHORS Spataro,V., Toda,T., Craig,R., Seeger,M., Dubiel,W., Harris,A.L.
and Norbury,C.
TITLE Resistance to diverse drugs and ultraviolet light conferred by
overexpression of a novel human 26 S proteasome subunit
JOURNAL J. Biol. Chem. 272 (48), 30470-30475 (1997)
PUBMED 9374539
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DA133201.1, BC066336.1,
U86782.1 and BM978668.1.
On Feb 11, 2012 this sequence version replaced gi:221307564.
Summary: This gene encodes a component of the 26S proteasome. The
26S proteasome is a large multiprotein complex that catalyzes the
degradation of ubiquitinated intracellular proteins. The encoded
protein is a component of the 19S regulatory cap complex of the 26S
proteasome and mediates substrate deubiquitination. A pseudogene of
this gene is also located on the long arm of chromosome 2.
[provided by RefSeq, Feb 2012].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK055128.1, BC066336.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025081, ERS025082 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-154 DA133201.1 1-154
155-1204 BC066336.1 1-1050
1205-1400 U86782.1 937-1132
1401-1734 BM978668.1 1-334 c
FEATURES Location/Qualifiers
source 1..1734
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="2"
/map="2q24.2"
gene 1..1734
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/note="proteasome (prosome, macropain) 26S subunit,
non-ATPase, 14"
/db_xref="GeneID:10213"
/db_xref="HGNC:16889"
/db_xref="HPRD:06208"
/db_xref="MIM:607173"
exon 1..330
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 37
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="g"
/db_xref="dbSNP:112037128"
variation 82
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="t"
/db_xref="dbSNP:146896366"
variation 98
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="g"
/db_xref="dbSNP:187123581"
variation 142
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="t"
/db_xref="dbSNP:191894240"
variation 223
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="t"
/db_xref="dbSNP:9713"
variation 318
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="t"
/db_xref="dbSNP:183359976"
variation 323
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:11546857"
exon 331..463
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 375
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="t"
/db_xref="dbSNP:144647588"
variation 384
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="t"
/db_xref="dbSNP:1136548"
misc_feature 450..452
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/note="upstream in-frame stop codon"
exon 464..515
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
CDS 468..1400
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/EC_number="3.1.2.15"
/note="26S proteasome regulatory subunit rpn11; 26S
proteasome-associated PAD1 homolog 1"
/codon_start=1
/product="26S proteasome non-ATPase regulatory subunit 14"
/protein_id="NP_005796.1"
/db_xref="GI:5031981"
/db_xref="CCDS:CCDS46437.1"
/db_xref="GeneID:10213"
/db_xref="HGNC:16889"
/db_xref="HPRD:06208"
/db_xref="MIM:607173"
/translation="
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
"
misc_feature 528..1325
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/note="Mov34/MPN/PAD-1 family: proteasomal regulatory
protein Rpn11 and signalosome complex subunit CSN5;
Region: MPN_RPN11_CSN5; cd08069"
/db_xref="CDD:163700"
misc_feature 561..563
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature order(621..623,804..806,810..812,834..836,843..845)
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/note="MPN+ (JAMM) motif; other site"
/db_xref="CDD:163700"
misc_feature 804..845
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (O00487.1);
Region: JAMM motif"
misc_feature order(804..806,810..812,843..845)
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/note="Zinc-binding site [ion binding]; other site"
/db_xref="CDD:163700"
misc_feature 915..917
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O00487.1); phosphorylation site"
misc_feature 1137..1139
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O00487.1); phosphorylation site"
variation 496
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="g"
/replace="t"
/db_xref="dbSNP:202245412"
exon 516..587
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
exon 588..707
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 593
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:11546859"
exon 708..778
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 740
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="t"
/db_xref="dbSNP:201192422"
exon 779..929
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 833
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="g"
/replace="t"
/db_xref="dbSNP:147288033"
variation 878
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:373164724"
variation 904
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:80038263"
exon 930..1037
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 1004
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:371311842"
exon 1038..1112
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 1074
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:374315217"
exon 1113..1238
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 1133
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:368096782"
variation 1163
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:199633612"
variation 1170
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:189753169"
variation 1186
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="t"
/db_xref="dbSNP:146149534"
exon 1239..1301
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
variation 1289
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="t"
/db_xref="dbSNP:370082078"
exon 1302..1717
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/inference="alignment:Splign:1.39.8"
STS 1315..1493
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/standard_name="RH91306"
/db_xref="UniSTS:86949"
variation 1355
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="t"
/db_xref="dbSNP:201522506"
variation 1406
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="t"
/db_xref="dbSNP:377532352"
variation 1486..1487
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace=""
/replace="gt"
/db_xref="dbSNP:71818353"
variation 1560
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="g"
/replace="t"
/db_xref="dbSNP:78317453"
variation 1597
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="a"
/replace="g"
/db_xref="dbSNP:1064576"
variation 1663
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
/replace="c"
/replace="g"
/db_xref="dbSNP:374221229"
polyA_signal 1696..1701
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
polyA_site 1717
/gene="PSMD14"
/gene_synonym="PAD1; POH1; RPN11"
ORIGIN
aagtgccgcctcacagtcctgccagagacaggagacgccgggccgcccgcgccgtctgtcccaagagctcctcctggacatccgcttgactctccgtcgtctccaattggccgtcggggaacggaagccgaagcaaactagtgaacccggaagtgcttcgcggcggaggcccgggcaactcttttgaatggaatcgggctgattcatcgccggtttgcagacagagccgcgtcgggtgtgcgccgctgctgctgttgcctctgtcttcgcgtcaccacagaggcaagacaagggtccatatcgcggcatccggctcccgcccgtcttcaggagagaaagaaaaaataaaatatacttggggaagttgtacctgccagaattagcaagagctttctttaagaagacatttgtcaaactcaacaaattgaaggttaacaccttaagagttgtagttactgaccagaaatatggacagacttcttagacttggaggaggtatgcctggactgggccaggggccacctacagatgctcctgcagtggacacagcagaacaagtctatatctcttccctggcactgttaaaaatgttaaaacatggccgtgctggagttccaatggaagttatgggtttgatgcttggagaatttgttgatgattataccgtcagagtgattgatgtgtttgctatgccacagtcaggaacaggtgtcagtgtggaggcagttgatccagtgttccaagctaaaatgttggatatgttgaagcagacaggaaggccggagatggttgttggttggtatcacagtcaccctggctttggttgttggctttctggtgtggatatcaacactcagcagagctttgaagccttgtcggagagagctgtggcagtggttgtggatcccattcagagtgtaaaaggaaaggttgttattgatgccttcagattgatcaatgctaatatgatggtcttaggacatgaaccaagacaaacaacttcgaatctgggtcacttaaacaagccatctatccaggcattaattcatggactaaacagacattattactccattactattaactatcggaaaaatgaactggaacagaagatgttgctaaatttgcataagaagagttggatggaaggtttgacacttcaggactacagtgaacattgtaaacacaatgaatcagtggtaaaagagatgttggaattagccaagaattacaataaggctgtagaagaagaagataagatgacacctgaacagctggcaataaagaatgttggcaagcaggaccccaaacgtcatttggaggaacatgtggatgtacttatgacctcaaatattgtccagtgtttagcagctatgttggatactgtcgtatttaaataaagcaacgaaaaacgctattaatgatgccttcagtgtatattcctctgttgttcctaatgctcaaaatcaagggacctctgaaggtgtacttggctaaatgtaagacatctggcatcatttgcagcactgtaacaccttcagtctcagttgtgcaattacttctgtttctttagtcagggtctttgcagattctaaagttatacatgaatacatcaaagtggacaaattttgttaagatcccatttaatatttgaaaaaatcagtagcacaaatatattttgattgtcacttacaaaataaaatacatttacagtctaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10213 -> Molecular function: GO:0004221 [ubiquitin thiolesterase activity] evidence: IMP
GeneID:10213 -> Molecular function: GO:0004221 [ubiquitin thiolesterase activity] evidence: TAS
GeneID:10213 -> Molecular function: GO:0008237 [metallopeptidase activity] evidence: TAS
GeneID:10213 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
GeneID:10213 -> Molecular function: GO:0061133 [endopeptidase activator activity] evidence: IMP
GeneID:10213 -> Molecular function: GO:0070628 [proteasome binding] evidence: IDA
GeneID:10213 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS
GeneID:10213 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS
GeneID:10213 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS
GeneID:10213 -> Biological process: GO:0000724 [double-strand break repair via homologous recombination] evidence: IMP
GeneID:10213 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS
GeneID:10213 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS
GeneID:10213 -> Biological process: GO:0006303 [double-strand break repair via nonhomologous end joining] evidence: IMP
GeneID:10213 -> Biological process: GO:0006511 [ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS
GeneID:10213 -> Biological process: GO:0010467 [gene expression] evidence: TAS
GeneID:10213 -> Biological process: GO:0010950 [positive regulation of endopeptidase activity] evidence: IMP
GeneID:10213 -> Biological process: GO:0016032 [viral process] evidence: TAS
GeneID:10213 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS
GeneID:10213 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
GeneID:10213 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:10213 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:10213 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS
GeneID:10213 -> Biological process: GO:0061136 [regulation of proteasomal protein catabolic process] evidence: IMP
GeneID:10213 -> Biological process: GO:0070536 [protein K63-linked deubiquitination] evidence: IMP
GeneID:10213 -> Biological process: GO:0070536 [protein K63-linked deubiquitination] evidence: TAS
GeneID:10213 -> Cellular component: GO:0000502 [proteasome complex] evidence: TAS
GeneID:10213 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS
GeneID:10213 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:10213 -> Cellular component: GO:0008541 [proteasome regulatory particle, lid subcomplex] evidence: IMP
GeneID:10213 -> Cellular component: GO:0022624 [proteasome accessory complex] evidence: ISS
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_005796 -> EC 3.1.2.15
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.