2024-05-08 11:25:41, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_005789 3455 bp mRNA linear PRI 17-APR-2013 DEFINITION Homo sapiens proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, mRNA. ACCESSION NM_005789 VERSION NM_005789.3 GI:388556513 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 3455) AUTHORS Ko,N.L., Taylor,J.M., Bellon,M., Bai,X.T., Shevtsov,S.P., Dundr,M. and Nicot,C. TITLE PA28gamma is a novel corepressor of HTLV-1 replication and controls viral latency JOURNAL Blood 121 (5), 791-800 (2013) PUBMED 23104922 REMARK GeneRIF: PA28gamma acts as a co-repressor of HTLV-1 p30 to suppress virus replication and is required for the maintenance of viral latency. REFERENCE 2 (bases 1 to 3455) AUTHORS Li,L.P., Cheng,W.B., Li,H., Li,W., Yang,H., Wen,D.H. and Tang,Y.D. TITLE Expression of proteasome activator REGgamma in human laryngeal carcinoma and associations with tumor suppressor proteins JOURNAL Asian Pac. J. Cancer Prev. 13 (6), 2699-2703 (2012) PUBMED 22938444 REMARK GeneRIF: statistical analysisof laryngeal carcinomas revealed that there was a positive relationship between the level of REGgamma and the expression of p53 and p2; study suggests that REgamma overexpression can facilitate the growth of laryngeal cancer cells REFERENCE 3 (bases 1 to 3455) AUTHORS Levy-Barda,A., Lerenthal,Y., Davis,A.J., Chung,Y.M., Essers,J., Shao,Z., van Vliet,N., Chen,D.J., Hu,M.C., Kanaar,R., Ziv,Y. and Shiloh,Y. TITLE Involvement of the nuclear proteasome activator PA28gamma in the cellular response to DNA double-strand breaks JOURNAL Cell Cycle 10 (24), 4300-4310 (2011) PUBMED 22134242 REMARK GeneRIF: PA28gamma is an ATM target, being recruited to DNA damage sites where it is required for rapid accumulation of proteasomes, and the timely coordination of DNA double-strand break repair. REFERENCE 4 (bases 1 to 3455) AUTHORS Kohda,K., Ishibashi,T., Shimbara,N., Tanaka,K., Matsuda,Y. and Kasahara,M. TITLE Characterization of the mouse PA28 activator complex gene family: complete organizations of the three member genes and a physical map of the approximately 150-kb region containing the alpha- and beta-subunit genes JOURNAL J. Immunol. 160 (10), 4923-4935 (1998) PUBMED 9590240 REFERENCE 5 (bases 1 to 3455) AUTHORS Seeger,M., Ferrell,K., Frank,R. and Dubiel,W. TITLE HIV-1 tat inhibits the 20 S proteasome and its 11 S regulator-mediated activation JOURNAL J. Biol. Chem. 272 (13), 8145-8148 (1997) PUBMED 9079628 REFERENCE 6 (bases 1 to 3455) AUTHORS Coux,O., Tanaka,K. and Goldberg,A.L. TITLE Structure and functions of the 20S and 26S proteasomes JOURNAL Annu. Rev. Biochem. 65, 801-847 (1996) PUBMED 8811196 REMARK Review article REFERENCE 7 (bases 1 to 3455) AUTHORS Jacob,A., Kandpal,G., Patanjali,S.R. and Kandpal,R.P. TITLE Molecular cloning and expression pattern of genes from a 470 Kb region near BRCA1 locus on chromosome 17q21 JOURNAL Oncogene 11 (5), 981-986 (1995) PUBMED 7675458 REFERENCE 8 (bases 1 to 3455) AUTHORS Miki,Y., Swensen,J., Shattuck-Eidens,D., Futreal,P.A., Harshman,K., Tavtigian,S., Liu,Q., Cochran,C., Bennett,L.M., Ding,W. et al. TITLE A strong candidate for the breast and ovarian cancer susceptibility gene BRCA1 JOURNAL Science 266 (5182), 66-71 (1994) PUBMED 7545954 REFERENCE 9 (bases 1 to 3455) AUTHORS Albertsen,H.M., Smith,S.A., Mazoyer,S., Fujimoto,E., Stevens,J., Williams,B., Rodriguez,P., Cropp,C.S., Slijepcevic,P., Carlson,M. et al. TITLE A physical map and candidate genes in the BRCA1 region on chromosome 17q12-21 JOURNAL Nat. Genet. 7 (4), 472-479 (1994) PUBMED 7951316 REFERENCE 10 (bases 1 to 3455) AUTHORS Nikaido,T., Shimada,K., Shibata,M., Hata,M., Sakamoto,M., Takasaki,Y., Sato,C., Takahashi,T. and Nishida,Y. TITLE Cloning and nucleotide sequence of cDNA for Ki antigen, a highly conserved nuclear protein detected with sera from patients with systemic lupus erythematosus JOURNAL Clin. Exp. Immunol. 79 (2), 209-214 (1990) PUBMED 1968796 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from BI464061.1, BC001423.2, AC016889.28 and AI304773.1. On May 26, 2012 this sequence version replaced gi:30410793. Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012]. Transcript Variant: This variant (1) encodes the predominant isoform (1). Sequence Note: This RefSeq record was created from transcript and genomic sequence data to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on transcript alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: BC001423.2, AK074999.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-273 BI464061.1 4-276 274-2925 BC001423.2 1-2652 2926-3429 AC016889.28 108861-109364 3430-3455 AI304773.1 1-26 c FEATURES Location/Qualifiers source 1..3455 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" /map="17q21" gene 1..3455 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /note="proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki)" /db_xref="GeneID:10197" /db_xref="HGNC:9570" /db_xref="HPRD:05500" /db_xref="MIM:605129" exon 1..532 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" variation 10 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="c" /db_xref="dbSNP:375225506" variation 38 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="g" /db_xref="dbSNP:185218030" variation 60 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:118072016" variation 169 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="g" /db_xref="dbSNP:7220766" variation 267 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:144157969" misc_feature 269..271 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /note="upstream in-frame stop codon" variation 322 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="c" /replace="g" /db_xref="dbSNP:11542144" variation 347 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:189726007" variation 421 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:11542143" variation 471 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:11542142" variation 490 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:139945697" CDS 491..1255 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /note="isoform 1 is encoded by transcript variant 1; Ki nuclear autoantigen; PA28 gamma variant 5; Ki antigen; proteasome activator 28-gamma; 11S regulator complex gamma subunit; activator of multicatalytic protease subunit 3; proteasome activator complex subunit 3; 11S regulator complex subunit gamma; proteasome activator 28 subunit gamma" /codon_start=1 /product="proteasome activator complex subunit 3 isoform 1" /protein_id="NP_005780.2" /db_xref="GI:30410794" /db_xref="CCDS:CCDS45689.1" /db_xref="GeneID:10197" /db_xref="HGNC:9570" /db_xref="HPRD:05500" /db_xref="MIM:605129" /translation="
MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
" misc_feature 494..496 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /experiment="experimental evidence, no additional details recorded" /note="N-acetylalanine; propagated from UniProtKB/Swiss-Prot (P61289.1); acetylation site" misc_feature 509..700 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /note="Proteasome activator pa28 alpha subunit; Region: PA28_alpha; pfam02251" /db_xref="CDD:145415" misc_feature 560..562 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (P61289.1); phosphorylation site" misc_feature 728..730 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:02799" misc_feature 728..730 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:03457" misc_feature 728..730 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /experiment="experimental evidence, no additional details recorded" /note="proteolytic cleavage site; modified site" /db_xref="HPRD:03321" misc_feature 803..1252 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /note="Proteasome activator pa28 beta subunit; Region: PA28_beta; pfam02252" /db_xref="CDD:145416" variation 500 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="g" /replace="t" /db_xref="dbSNP:11542141" variation 515 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="g" /db_xref="dbSNP:181426790" exon 533..565 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" exon 566..628 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" exon 629..733 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" variation 648 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:373928182" variation 716 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:111470609" exon 734..782 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" exon 783..895 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" variation 807 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:377275510" variation 863 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:371137053" variation 872 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:374111752" exon 896..964 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" variation 955 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:146329887" exon 965..1032 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" variation 1009 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:376102848" exon 1033..1087 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" variation 1036 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:376784465" exon 1088..1174 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" variation 1105 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:139649789" variation 1147 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:144379026" variation 1162 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:368656313" exon 1175..3437 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /inference="alignment:Splign:1.39.8" variation 1184 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:200192436" variation 1195 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="c" /db_xref="dbSNP:368470629" variation 1207 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:202070240" variation 1259 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:372417727" variation 1304 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:376013489" variation 1327 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:11542140" variation 1334 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:80340976" variation 1486 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:111565009" variation 1487 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:138778726" variation 1556 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="c" /db_xref="dbSNP:376501511" variation 1599 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:185308245" variation 1605..1608 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="" /replace="taat" /db_xref="dbSNP:10542459" variation 1607..1610 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="" /replace="atta" /db_xref="dbSNP:371175158" variation 1607 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:199670623" variation 1752 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:12185238" variation 1810 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="g" /db_xref="dbSNP:16968036" variation 2015 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:188953781" variation 2044 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="c" /db_xref="dbSNP:181550421" variation 2147..2148 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="" /replace="c" /db_xref="dbSNP:34030346" variation 2159 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="c" /db_xref="dbSNP:187634243" variation 2189 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:144526875" variation 2284..2289 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="" /replace="ctcttt" /db_xref="dbSNP:374650825" variation 2355 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:376343613" variation 2369 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="g" /replace="t" /db_xref="dbSNP:191910662" variation 2615 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:115860809" variation 2617 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:369381831" STS 2696..2838 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /standard_name="RH16239" /db_xref="UniSTS:2879" variation 2737 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="g" /db_xref="dbSNP:1056730" variation 2743 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:182960547" variation 2781 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:34878294" variation 2877 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="g" /db_xref="dbSNP:186029887" variation 2909 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="c" /db_xref="dbSNP:34989919" variation 2924 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:373608001" STS 2927..3095 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /standard_name="STS-U11292" /db_xref="UniSTS:9169" variation 2943 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="g" /replace="t" /db_xref="dbSNP:35756762" variation 2946 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:35704777" variation 3037..3038 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="" /replace="ag" /db_xref="dbSNP:71825604" variation 3134 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:139296430" variation 3196 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="g" /db_xref="dbSNP:377471565" STS 3237..3387 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /standard_name="RH47258" /db_xref="UniSTS:72254" variation 3241 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:111722913" variation 3303 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="c" /replace="t" /db_xref="dbSNP:186987705" variation 3308 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:35759054" variation 3344 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" /replace="a" /replace="g" /db_xref="dbSNP:192322990" polyA_signal 3408..3413 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" polyA_site 3437 /gene="PSME3" /gene_synonym="Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA" ORIGIN
ggagtgcagcggctgagaaggtcccttcggtgaaggcgagttccgggacaacagagagggccgcaccgtttccgagtctctcggaggctcagttctcagcgcaccattccccacagctctcctttttactttacccctacccgacacttgaccccggcagtgtgaaccccgctgggagcgtccaaagccatgcctcatcgcggctgcgcagcgcacgtgcacagcctcgcaggagtctcggcgattggctgtgacgcagtttccggcgtgagcggcgaaagccgggagggcgagcgagagagcaagcaggcagcaggctgccggcgggcgggcggacggcacagagggagggagcgagcgagcagtgagtaagccagcaagggcggtcgggtcccgaggtcagccgagatttctcaggtccctccggccccctccctggagtccacagcgcctccggtgtccagaggatcggacacggcccggcccggccatggcctcgttgctgaaggtggatcaggaagtgaagctcaaggttgattctttcagggagcggatcacaagtgaggcagaagacttggtggcaaattttttcccaaagaagttattagaacttgatagttttctgaaggaaccaatcttaaacatccatgacctaactcagatccactctgacatgaatctcccagtccctgaccccattcttctcaccaatagccatgatggactggatggtcccacttataagaagcgaaggttggatgagtgtgaagaagccttccaaggaaccaaggtgtttgtgatgcccaatgggatgctgaaaagcaaccagcagctggtggacattattgagaaagtgaaacctgagatccggctgttgattgagaaatgtaacacggtcaaaatgtgggtacagctcctgattcccaggatagaagatggaaacaactttggggtgtccattcaggaggaaacagttgcagagctaagaactgttgagagtgaagctgcatcttatctggaccagatttctagatattatattacaagagccaaattggtttctaaaatagctaaatatccccatgtggaggactatcgccgcaccgtgacagagattgatgagaaagaatatatcagccttcggctcatcatatcagagctgaggaatcaatatgtcactctacatgacatgatcctgaaaaatatcgagaagatcaaacggccccggagcagcaatgcagagactctgtactgaggccagggccagggccaggggactctgtgagtctggctcaagaccgacattgccttggtttgttacatgactatcgtgatggggaaactggctggaaatagtaatcacacctctctgtttttagttagagtctaatgaaactctcatctagttctgtgatgtgtttacctcttttttcaggcctcaggaactcttctatttccttccctaataccccacacccaacctgtcgtaatttctggagaactccaggtttgtgtgtgcaggatgttggcacaaaaatacctgtgttttcattctccccctctctccctcctgtgtcttgcgctttatgttttcttccgtttgataattagttggttaaaagctgagggaaccggaaggaaagtgctaggtgttttttaggaactagggtggcggggggacgaacttctcttcctcacatgaggttactgtttctttcctctgtggggcattggatcctcccacagttgccctggtgatgacttagggcttcccatctgtgtacatcccactttgaatcttgatcgtgacaagaaataccttaggccttcagtcaattccgaagctccttcagttgtttttataatgggcgttttcacatgcacatatgtgtatgcatgtatacgcccatacagacatgcacacacagactcctactccattagctaacataccctccctctccacaacccctgtcacatacctttcaggaggtgacagttgtcttagttgtcatctacccagacaaacgtcctgggcccgtcctccctcctgatactgtagcctcttggtacccagggtgagttggtggagaacagagagatgagaagcagagggcttggggaaagcctgttcctctctgactcagccctttttggcattattgcaagagcttgactcctggttgccttttcccagccagttttcagttggggtgaaggtttctgcaagtgtgaggtccagatgctgctgctcatgttgggctttccttttgggaactatttctctttatttatagtgtcgggcttccggggaaagcaatcattggtgtgtatgtgtatgtgcatgcacacacgtgcatatacacatttgtgtatgtggaaatgtgctgggcaagtcaaaactatagaagagttgcctcctgtctctcgaatcttccagagatatcacttaattgttaacagcttttgtgttaatccccttcagcccctagctcttttattctaccacggctggagagttgatacctgcagtcagcctgccagtgactcttagtgtctgtttctgacttatttttcctgtctctgtcttccaacccccaataatatttccaccggggatgcatcatttttactcccaatattctgtagagagggagtcaggatgctgtcttcccacgaatagtactcagtaacaaaccaattgcattttagttgggcagtgctcccacccaccctccagatcccttccagctaaaacccttcccccttccctccatgtgtttctcagtttcccgtttcgtttgttggactgttccactgcccctcctcctcaccctatcacccatggatcgtaatgtaaaattcttttaccatgtcaagaaattattaaaaatacaggtactttgacctctttctaaagccgcagaccctggtgcaatgctctggtggctagggatgtactcatgctcatatgtgtgcacgcttggacacccacctccatggacacctagccaccctgttgtgtgtccttatgccagttgagctgaatcttttccccagtatagtggaaagactgaggcttctgcctactgagcaaggttgggtgcttcatttgtgttcagtctgaattatgggaaagttagctcttcccagacctaagctgccttctctccctactttcagaagatcctagttccttccttcccgagtgatacccatgaactgccagtagaggctgctatcgttccatgtgtaaggaatgaactggttcaaggcgcgtcctacccagtcattttctttaccttatactaattcttcctgaataatgtcttcagtttcttgaggagactcctagttttggttttcaaattacttggagggctgcctaggaatctatctccctctgaaataaagtttcctcatcttccaccttgcaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:10197 -> Molecular function: GO:0002039 [p53 binding] evidence: IDA GeneID:10197 -> Molecular function: GO:0005515 [protein binding] evidence: IPI GeneID:10197 -> Molecular function: GO:0061133 [endopeptidase activator activity] evidence: IDA GeneID:10197 -> Molecular function: GO:0097371 [MDM2/MDM4 family protein binding] evidence: IDA GeneID:10197 -> Biological process: GO:0000082 [G1/S transition of mitotic cell cycle] evidence: TAS GeneID:10197 -> Biological process: GO:0000209 [protein polyubiquitination] evidence: TAS GeneID:10197 -> Biological process: GO:0000278 [mitotic cell cycle] evidence: TAS GeneID:10197 -> Biological process: GO:0002474 [antigen processing and presentation of peptide antigen via MHC class I] evidence: TAS GeneID:10197 -> Biological process: GO:0002479 [antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent] evidence: TAS GeneID:10197 -> Biological process: GO:0006521 [regulation of cellular amino acid metabolic process] evidence: TAS GeneID:10197 -> Biological process: GO:0006915 [apoptotic process] evidence: TAS GeneID:10197 -> Biological process: GO:0006977 [DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest] evidence: TAS GeneID:10197 -> Biological process: GO:0010467 [gene expression] evidence: TAS GeneID:10197 -> Biological process: GO:0010950 [positive regulation of endopeptidase activity] evidence: IDA GeneID:10197 -> Biological process: GO:0016032 [viral process] evidence: TAS GeneID:10197 -> Biological process: GO:0016070 [RNA metabolic process] evidence: TAS GeneID:10197 -> Biological process: GO:0016071 [mRNA metabolic process] evidence: TAS GeneID:10197 -> Biological process: GO:0031145 [anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process] evidence: TAS GeneID:10197 -> Biological process: GO:0034641 [cellular nitrogen compound metabolic process] evidence: TAS GeneID:10197 -> Biological process: GO:0042590 [antigen processing and presentation of exogenous peptide antigen via MHC class I] evidence: TAS GeneID:10197 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS GeneID:10197 -> Biological process: GO:0043066 [negative regulation of apoptotic process] evidence: TAS GeneID:10197 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS GeneID:10197 -> Biological process: GO:0051436 [negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS GeneID:10197 -> Biological process: GO:0051437 [positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS GeneID:10197 -> Biological process: GO:0051439 [regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle] evidence: TAS GeneID:10197 -> Biological process: GO:0061136 [regulation of proteasomal protein catabolic process] evidence: IDA GeneID:10197 -> Biological process: GO:2001237 [negative regulation of extrinsic apoptotic signaling pathway] evidence: IDA GeneID:10197 -> Cellular component: GO:0000502 [proteasome complex] evidence: TAS GeneID:10197 -> Cellular component: GO:0005654 [nucleoplasm] evidence: TAS GeneID:10197 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:10197 -> Cellular component: GO:0008537 [proteasome activator complex] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.