Home |
Help |
Advanced search
2024-04-20 10:47:19, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_005727 1639 bp mRNA linear PRI 17-APR-2013
DEFINITION Homo sapiens tetraspanin 1 (TSPAN1), mRNA.
ACCESSION NM_005727
VERSION NM_005727.3 GI:274317624
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1639)
AUTHORS Wang,G.L., Chen,L., Wei,Y.Z., Zhou,J.M., Wu,Y.Y., Zhang,Y.X.,
Qin,J. and Zhu,Y.Y.
TITLE The effect of NET-1 on the proliferation, migration and endocytosis
of the SMMC-7721 HCC cell line
JOURNAL Oncol. Rep. 27 (6), 1944-1952 (2012)
PUBMED 22378020
REMARK GeneRIF: data suggest that the NET-1 gene may play an important
role in proliferation, migration and endocytosis in the development
and progress of hepatocellular carcinoma
REFERENCE 2 (bases 1 to 1639)
AUTHORS Nabokina,S.M., Senthilkumar,S.R. and Said,H.M.
TITLE Tspan-1 interacts with the thiamine transporter-1 in human
intestinal epithelial cells and modulates its stability
JOURNAL Am. J. Physiol. Gastrointest. Liver Physiol. 301 (5), G808-G813
(2011)
PUBMED 21836059
REMARK GeneRIF: These studies demonstrate for the first time that Tspan-1
is an interacting partner with human thiamine transporter-1 and
that this interaction affects thiamine transporter-1 stability.
REFERENCE 3 (bases 1 to 1639)
AUTHORS Huang,Y.K., Fan,X.G., Qiu,F. and Wang,Z.M.
TITLE Genomics of hepatitis B virus-related hepatocellular carcinoma and
adjacent noncancerous tissues with cDNA microarray
JOURNAL Chin. Med. J. 124 (13), 2057-2064 (2011)
PUBMED 22088470
REMARK GeneRIF: Study provided the gene expression profile of HBV-related
HCC and presented differential expression patterns of SATB-1,
TM4SF-1 and ST-14 between cancerous and noncancerous tissues in
patients with HBV-related HCC.
REFERENCE 4 (bases 1 to 1639)
AUTHORS Chen,L., Yuan,D., Wang,G.L., Wang,Y., Wu,Y.Y. and Zhu,J.
TITLE Clinicopathological significance of expression of Tspan-1, Jab1 and
p27 in human hepatocellular carcinoma
JOURNAL J. Korean Med. Sci. 25 (10), 1438-1442 (2010)
PUBMED 20890423
REMARK GeneRIF: The overexpression of Tspan-1 was found in HCC tissues,
positively correlated with clinical stage and negatively correlated
with survival rate.
REFERENCE 5 (bases 1 to 1639)
AUTHORS Chen,L., Yuan,D., Zhao,R., Li,H. and Zhu,J.
TITLE Suppression of TSPAN1 by RNA interference inhibits proliferation
and invasion of colon cancer cells in vitro
JOURNAL Tumori 96 (5), 744-750 (2010)
PUBMED 21302622
REMARK GeneRIF: RNAi-mediated downregulation of TSPAN1 expression
significantly inhibits the proliferation and invasion of colon
cancer cells in vitro.
REFERENCE 6 (bases 1 to 1639)
AUTHORS Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J.,
Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and
Kim,N.S.
TITLE Transcriptome analysis of human gastric cancer
JOURNAL Mamm. Genome 16 (12), 942-954 (2005)
PUBMED 16341674
REFERENCE 7 (bases 1 to 1639)
AUTHORS Wollscheid,V., Kuhne-Heid,R., Stein,I., Jansen,L., Kollner,S.,
Schneider,A. and Durst,M.
TITLE Identification of a new proliferation-associated protein NET-1/C4.8
characteristic for a subset of high-grade cervical intraepithelial
neoplasia and cervical carcinomas
JOURNAL Int. J. Cancer 99 (6), 771-775 (2002)
PUBMED 12115476
REMARK GeneRIF: Overexpression of NET-1 is associated with
undifferentiated squamous cell carcinoma of cervical neoplasms
REFERENCE 8 (bases 1 to 1639)
AUTHORS Berditchevski,F.
TITLE Complexes of tetraspanins with integrins: more than meets the eye
JOURNAL J. Cell. Sci. 114 (PT 23), 4143-4151 (2001)
PUBMED 11739647
REMARK Review article
REFERENCE 9 (bases 1 to 1639)
AUTHORS Serru,V., Dessen,P., Boucheix,C. and Rubinstein,E.
TITLE Sequence and expression of seven new tetraspans
JOURNAL Biochim. Biophys. Acta 1478 (1), 159-163 (2000)
PUBMED 10719184
REFERENCE 10 (bases 1 to 1639)
AUTHORS Todd,S.C., Doctor,V.S. and Levy,S.
TITLE Sequences and expression of six new members of the
tetraspanin/TM4SF family
JOURNAL Biochim. Biophys. Acta 1399 (1), 101-104 (1998)
PUBMED 9714763
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from BM908049.1, AL672043.15,
AK313774.1, AF065388.1 and BM856468.1.
On Dec 12, 2009 this sequence version replaced gi:21264577.
Summary: The protein encoded by this gene is a member of the
transmembrane 4 superfamily, also known as the tetraspanin family.
Most of these members are cell-surface proteins that are
characterized by the presence of four hydrophobic domains. The
proteins mediate signal transduction events that play a role in the
regulation of cell development, activation, growth and motility.
[provided by RefSeq, Jul 2008].
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AK313774.1 [ECO:0000332]
RNAseq introns :: single sample supports all introns
ERS025084, ERS025085 [ECO:0000348]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-6 BM908049.1 5-10
7-10 AL672043.15 30864-30867
11-1200 AK313774.1 1-1190
1201-1625 AF065388.1 848-1272
1626-1639 BM856468.1 261-274
FEATURES Location/Qualifiers
source 1..1639
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="1"
/map="1p34.1"
gene 1..1639
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/note="tetraspanin 1"
/db_xref="GeneID:10103"
/db_xref="HGNC:20657"
/db_xref="HPRD:18232"
/db_xref="MIM:613170"
exon 1..333
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
variation 86
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:375081986"
variation 99
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="t"
/db_xref="dbSNP:377295877"
exon 334..466
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
variation 374
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:143274549"
misc_feature 460..462
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/note="upstream in-frame stop codon"
exon 467..531
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
CDS 475..1200
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/note="tetraspan 1"
/codon_start=1
/product="tetraspanin-1"
/protein_id="NP_005718.2"
/db_xref="GI:21264578"
/db_xref="CCDS:CCDS530.1"
/db_xref="GeneID:10103"
/db_xref="HGNC:20657"
/db_xref="HPRD:18232"
/db_xref="MIM:613170"
/translation="
MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGIGGLELAAMIVSMYLYCNLQ
"
misc_feature 490..1194
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/note="Tetraspanin family; Region: Tetraspannin;
pfam00335"
/db_xref="CDD:201163"
misc_feature 508..570
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O60635.2);
transmembrane region"
misc_feature 631..693
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O60635.2);
transmembrane region"
misc_feature 739..801
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O60635.2);
transmembrane region"
misc_feature 802..1107
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/note="Tetraspanin, extracellular domain or large
extracellular loop (LEL), uroplakin_I_like family.
Tetraspanins are trans-membrane proteins with 4
trans-membrane segments. Both the N- and C-termini lie on
the intracellular side of the membrane. This alignment...;
Region: uroplakin_I_like_LEL; cd03156"
/db_xref="CDD:48420"
misc_feature order(811..813,823..825,829..834,841..843,889..891,
898..903,910..915)
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/note="dimer interface [polypeptide binding]; other site"
/db_xref="CDD:48420"
misc_feature 895..897
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 934..936
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 1006..1008
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 1024..1026
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/experiment="experimental evidence, no additional details
recorded"
/note="glycosylation site"
misc_feature 1108..1170
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (O60635.2);
transmembrane region"
variation 475
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:2234266"
variation 505
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:184135661"
exon 532..738
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
variation 533
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:181648118"
variation 560
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:201704042"
variation 587
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:2234267"
variation 591
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:150230789"
variation 603
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:138700033"
variation 632
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:138801780"
variation 664
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:143584741"
variation 666
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:145996817"
variation 667
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:138721574"
variation 672
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="g"
/db_xref="dbSNP:139002111"
variation 714
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:35000902"
variation 733
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:2234268"
variation 737
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:372580265"
exon 739..813
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
variation 743
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:145702144"
variation 793
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:375028085"
exon 814..912
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
variation 831
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:140948297"
variation 899
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="c"
/db_xref="dbSNP:41286815"
exon 913..1068
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
variation 939
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:111543379"
variation 941
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:201800369"
variation 942
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:146559665"
variation 1009
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:370460447"
variation 1039
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:1047216"
variation 1044
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:201547396"
variation 1054
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:200479864"
exon 1069..1152
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
variation 1073
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="g"
/db_xref="dbSNP:370368119"
variation 1093
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="g"
/replace="t"
/db_xref="dbSNP:144913574"
variation 1100
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:375232447"
variation 1116
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:368462173"
variation 1117
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:149302587"
variation 1137
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:200863715"
variation 1150
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:371861627"
exon 1153..1629
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/inference="alignment:Splign:1.39.8"
variation 1164
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:34463133"
variation 1176
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="g"
/db_xref="dbSNP:376073263"
variation 1197
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:147137223"
variation 1217
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:199685801"
variation 1250
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:201843939"
variation 1253
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="g"
/db_xref="dbSNP:112015052"
variation 1291
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:1802371"
variation 1336
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:373512282"
STS 1430..1590
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/standard_name="SHGC-74773"
/db_xref="UniSTS:67619"
variation 1447
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="t"
/db_xref="dbSNP:1802372"
variation 1473
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="t"
/db_xref="dbSNP:1802309"
variation 1482
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="c"
/replace="g"
/db_xref="dbSNP:11552232"
variation 1614
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
/replace="a"
/replace="t"
/db_xref="dbSNP:112046563"
polyA_site 1629
/gene="TSPAN1"
/gene_synonym="NET1; TM4C; TM4SF"
ORIGIN
tcccggcctcagacacacacaccagcagctacacctacacgctgaccatcacaggcacacagaggcacatccacctcacatccacctcatacttgtgtactctcagggttcagtctttcatcctatccctctctgatctgtgcctcccaataccttccaagatgtttacagagacccttctccctgtgcagttaggagtgtaaggcaagagagcccctacttcatggggcagatcaagagctgagaccaaagatggtctatgttgctgaccttgtcctgtcctcctgctgtcttaaactatgatccctgctgcggtcactgaagcctttccctgtgagcagtggtgtgtgagagccaggcgtccctctgcctgcccactcagtggcaacacccgggagctgttttgtcctttgtggagcctcagcagttccctctttcagaactcactgccaagagccctgaacaggagccaccatgcagtgcttcagcttcattaagaccatgatgatcctcttcaatttgctcatctttctgtgtggtgcagccctgttggcagtgggcatctgggtgtcaatcgatggggcatcctttctgaagatcttcgggccactgtcgtccagtgccatgcagtttgtcaacgtgggctacttcctcatcgcagccggcgttgtggtctttgctcttggtttcctgggctgctatggtgctaagactgagagcaagtgtgccctcgtgacgttcttcttcatcctcctcctcatcttcattgctgaggttgcagctgctgtggtcgccttggtgtacaccacaatggctgagcacttcctgacgttgctggtagtgcctgccatcaagaaagattatggttcccaggaagacttcactcaagtgtggaacaccaccatgaaagggctcaagtgctgtggcttcaccaactatacggattttgaggactcaccctacttcaaagagaacagtgcctttcccccattctgttgcaatgacaacgtcaccaacacagccaatgaaacctgcaccaagcaaaaggctcacgaccaaaaagtagagggttgcttcaatcagcttttgtatgacatccgaactaatgcagtcaccgtgggtggtgtggcagctggaattgggggcctcgagctggctgccatgattgtgtccatgtatctgtactgcaatctacaataagtccacttctgcctctgccactactgctgccacatgggaactgtgaagaggcaccctggcaagcagcagtgattgggggaggggacaggatctaacaatgtcacttgggccagaatggacctgccctttctgctccagacttggggctagatagggaccactccttttaggcgatgcctgactttccttccattggtgggtggatgggtggggggcattccagagcctctaaggtagccagttctgttgcccattcccccagtctattaaacccttgatatgccccctaggcctagtggtgatcccagtgctctactgggggatgagagaaaggcattttatagcctgggcataagtgaaatcagcagagcctctgggtggatgtgtagaaggcacttcaaaatgcataaacctgttacaatgttgccaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:10103 -> Cellular component: GO:0005765 [lysosomal membrane] evidence: IEA
GeneID:10103 -> Cellular component: GO:0016021 [integral to membrane] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.