2024-04-26 06:45:40, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_005627 2414 bp mRNA linear PRI 15-JUL-2013 DEFINITION Homo sapiens serum/glucocorticoid regulated kinase 1 (SGK1), transcript variant 1, mRNA. ACCESSION NM_005627 VERSION NM_005627.3 GI:163644253 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2414) AUTHORS Alamares-Sapuay,J.G., Martinez-Gil,L., Stertz,S., Miller,M.S., Shaw,M.L. and Palese,P. TITLE Serum- and glucocorticoid-regulated kinase 1 is required for nuclear export of the ribonucleoprotein of influenza A virus JOURNAL J. Virol. 87 (10), 6020-6026 (2013) PUBMED 23487453 REMARK GeneRIF: Authors also demonstrate that SGK1 is required for influenza A virus ribonucleoprotein nuclear export. REFERENCE 2 (bases 1 to 2414) AUTHORS Velez Edwards,D.R., Naj,A.C., Monda,K., North,K.E., Neuhouser,M., Magvanjav,O., Kusimo,I., Vitolins,M.Z., Manson,J.E., O'Sullivan,M.J., Rampersaud,E. and Edwards,T.L. TITLE Gene-environment interactions and obesity traits among postmenopausal African-American and Hispanic women in the Women's Health Initiative SHARe Study JOURNAL Hum. Genet. 132 (3), 323-336 (2013) PUBMED 23192594 REFERENCE 3 (bases 1 to 2414) AUTHORS Miranda,P., Cadaveira-Mosquera,A., Gonzalez-Montelongo,R., Villarroel,A., Gonzalez-Hernandez,T., Lamas,J.A., Alvarez de la Rosa,D. and Giraldez,T. TITLE The neuronal serum- and glucocorticoid-regulated kinase 1.1 reduces neuronal excitability and protects against seizures through upregulation of the M-current JOURNAL J. Neurosci. 33 (6), 2684-2696 (2013) PUBMED 23392695 REMARK GeneRIF: Transgenic mice with increased SGK1.1 activity shows diminished sensitivity to induced seizures. REFERENCE 4 (bases 1 to 2414) AUTHORS Raikwar,N.S., Liu,K.Z. and Thomas,C.P. TITLE A regulated NH2-terminal Sgk1 variant with enhanced function is expressed in the collecting duct JOURNAL Am. J. Physiol. Renal Physiol. 303 (11), F1527-F1533 (2012) PUBMED 23034940 REMARK GeneRIF: Renally expressed Sgk1 isoform, Sgk1_i3, stimulates ENaC activity when heterologously expressed in collecting duct cells. REFERENCE 5 (bases 1 to 2414) AUTHORS Ronchi,C.L., Sbiera,S., Leich,E., Tissier,F., Steinhauer,S., Deutschbein,T., Fassnacht,M. and Allolio,B. TITLE Low SGK1 expression in human adrenocortical tumors is associated with ACTH-independent glucocorticoid secretion and poor prognosis JOURNAL J. Clin. Endocrinol. Metab. 97 (12), E2251-E2260 (2012) PUBMED 23055545 REMARK GeneRIF: Low SGK1 expression is related to ACTH-independent cortisol secretion in adrenocortical tumors and is a new prognostic factor in adrenocortical carcinoma. REFERENCE 6 (bases 1 to 2414) AUTHORS Kobayashi,T., Deak,M., Morrice,N. and Cohen,P. TITLE Characterization of the structure and regulation of two novel isoforms of serum- and glucocorticoid-induced protein kinase JOURNAL Biochem. J. 344 (PT 1), 189-197 (1999) PUBMED 10548550 REFERENCE 7 (bases 1 to 2414) AUTHORS Park,J., Leong,M.L., Buse,P., Maiyar,A.C., Firestone,G.L. and Hemmings,B.A. TITLE Serum and glucocorticoid-inducible kinase (SGK) is a target of the PI 3-kinase-stimulated signaling pathway JOURNAL EMBO J. 18 (11), 3024-3033 (1999) PUBMED 10357815 REFERENCE 8 (bases 1 to 2414) AUTHORS Kobayashi,T. and Cohen,P. TITLE Activation of serum- and glucocorticoid-regulated protein kinase by agonists that activate phosphatidylinositide 3-kinase is mediated by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2 JOURNAL Biochem. J. 339 (PT 2), 319-328 (1999) PUBMED 10191262 REFERENCE 9 (bases 1 to 2414) AUTHORS Waldegger,S., Erdel,M., Nagl,U.O., Barth,P., Raber,G., Steuer,S., Utermann,G., Paulmichl,M. and Lang,F. TITLE Genomic organization and chromosomal localization of the human SGK protein kinase gene JOURNAL Genomics 51 (2), 299-302 (1998) PUBMED 9722955 REFERENCE 10 (bases 1 to 2414) AUTHORS Waldegger,S., Barth,P., Raber,G. and Lang,F. TITLE Cloning and characterization of a putative human serine/threonine protein kinase transcriptionally modified during anisotonic and isotonic alterations of cell volume JOURNAL Proc. Natl. Acad. Sci. U.S.A. 94 (9), 4440-4445 (1997) PUBMED 9114008 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from DB450096.1, AK098509.1 and BP384292.1. On Dec 20, 2007 this sequence version replaced gi:25168262. Summary: This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009]. Transcript Variant: This variant (1) represents the predominant transcript and encodes the shortest isoform (1). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AF153609.1, BC001263.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-32 DB450096.1 1-32 33-2396 AK098509.1 1-2364 2397-2414 BP384292.1 485-502 FEATURES Location/Qualifiers source 1..2414 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="6" /map="6q23" gene 1..2414 /gene="SGK1" /gene_synonym="SGK" /note="serum/glucocorticoid regulated kinase 1" /db_xref="GeneID:6446" /db_xref="HGNC:10810" /db_xref="HPRD:04264" /db_xref="MIM:602958" exon 1..165 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" misc_feature 54..56 /gene="SGK1" /gene_synonym="SGK" /note="upstream in-frame stop codon" CDS 90..1385 /gene="SGK1" /gene_synonym="SGK" /EC_number="2.7.11.1" /note="isoform 1 is encoded by transcript variant 1; serine/threonine protein kinase SGK; serine/threonine-protein kinase Sgk1; serum/glucocorticoid-regulated kinase 1; Sgk1 variant i3" /codon_start=1 /product="serine/threonine-protein kinase Sgk1 isoform 1" /protein_id="NP_005618.2" /db_xref="GI:25168263" /db_xref="CCDS:CCDS5170.1" /db_xref="GeneID:6446" /db_xref="HGNC:10810" /db_xref="HPRD:04264" /db_xref="MIM:602958" /translation="
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
" misc_feature 90..269 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O00141.2); Region: Necessary for localization to the mitochondria" misc_feature <168..263 /gene="SGK1" /gene_synonym="SGK" /note="The Phox Homology domain, a phosphoinositide binding module; Region: PX_domain; cl02563" /db_xref="CDD:207644" misc_feature 309..311 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O00141.2); phosphorylation site" misc_feature 321..323 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine, by MAPK7; propagated from UniProtKB/Swiss-Prot (O00141.2); phosphorylation site" misc_feature 321..323 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:03952" misc_feature 381..1154 /gene="SGK1" /gene_synonym="SGK" /note="Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220" /db_xref="CDD:197582" misc_feature 393..1367 /gene="SGK1" /gene_synonym="SGK" /note="Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1; Region: STKc_SGK1; cd05602" /db_xref="CDD:173693" misc_feature order(399..404,408..419,423..425,462..464,468..470, 567..569,618..620,624..626,636..638,642..644,753..755, 759..761,765..770,774..776,804..809,816..818,858..875, 954..956,972..974,981..983) /gene="SGK1" /gene_synonym="SGK" /note="active site" /db_xref="CDD:173693" misc_feature order(399..404,408..419,423..425,462..464,468..470, 567..569,618..620,624..626,759..761,765..770,774..776, 804..806) /gene="SGK1" /gene_synonym="SGK" /note="ATP binding site [chemical binding]; other site" /db_xref="CDD:173693" misc_feature order(411..413,636..638,642..644,753..755,759..761, 765..767,816..818,858..875,954..956,972..974,981..983) /gene="SGK1" /gene_synonym="SGK" /note="substrate binding site [chemical binding]; other site" /db_xref="CDD:173693" misc_feature 480..512 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="propagated from UniProtKB/Swiss-Prot (O00141.2); Region: Nuclear localization signal" misc_feature 804..875 /gene="SGK1" /gene_synonym="SGK" /note="activation loop (A-loop); other site" /db_xref="CDD:173693" misc_feature 855..857 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by PDPK1; propagated from UniProtKB/Swiss-Prot (O00141.2); phosphorylation site" misc_feature 855..857 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[7] /citation=[8] /db_xref="HPRD:05556" misc_feature 855..857 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[8] misc_feature 1194..1196 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="Phosphothreonine, by PKA; propagated from UniProtKB/Swiss-Prot (O00141.2); phosphorylation site" misc_feature 1218..1220 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /db_xref="HPRD:05348" misc_feature 1278..1280 /gene="SGK1" /gene_synonym="SGK" /note="turn motif phosphorylation site [posttranslational modification]; other site" /db_xref="CDD:173693" misc_feature 1278..1280 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O00141.2); phosphorylation site" misc_feature 1290..1292 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O00141.2); phosphorylation site" misc_feature 1341..1358 /gene="SGK1" /gene_synonym="SGK" /note="hydrophobic motif (HM); other site" /db_xref="CDD:173693" misc_feature 1353..1355 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="Phosphoserine; propagated from UniProtKB/Swiss-Prot (O00141.2); phosphorylation site" misc_feature 1353..1355 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[8] /db_xref="HPRD:05348" misc_feature 1353..1355 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[8] /db_xref="HPRD:05556" misc_feature 1353..1355 /gene="SGK1" /gene_synonym="SGK" /experiment="experimental evidence, no additional details recorded" /note="phosphorylation site" /citation=[8] exon 166..241 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" exon 242..317 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" variation 279 /gene="SGK1" /gene_synonym="SGK" /replace="a" /replace="c" /db_xref="dbSNP:11554163" exon 318..422 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" exon 423..506 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" exon 507..638 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" exon 639..751 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" exon 752..875 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" variation 809 /gene="SGK1" /gene_synonym="SGK" /replace="c" /replace="t" /db_xref="dbSNP:1057293" STS 812..1029 /gene="SGK1" /gene_synonym="SGK" /standard_name="MARC_12229-12230:1007996328:1" /db_xref="UniSTS:267375" exon 876..971 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" exon 972..1127 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" variation 976..977 /gene="SGK1" /gene_synonym="SGK" /replace="c" /replace="t" /db_xref="dbSNP:1057934" variation 1022 /gene="SGK1" /gene_synonym="SGK" /replace="a" /replace="c" /db_xref="dbSNP:78176488" exon 1128..1217 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" exon 1218..2407 /gene="SGK1" /gene_synonym="SGK" /inference="alignment:Splign:1.39.8" STS 1231..1353 /gene="SGK1" /gene_synonym="SGK" /standard_name="RH16308" /db_xref="UniSTS:9291" variation 1232 /gene="SGK1" /gene_synonym="SGK" /replace="c" /replace="g" /db_xref="dbSNP:1135343" variation 1539..1540 /gene="SGK1" /gene_synonym="SGK" /replace="g" /replace="t" /db_xref="dbSNP:1057300" variation 1781 /gene="SGK1" /gene_synonym="SGK" /replace="a" /replace="g" /db_xref="dbSNP:11554162" STS 1808..2097 /gene="SGK1" /gene_synonym="SGK" /standard_name="PMC86685P1" /db_xref="UniSTS:273543" STS 1999..2128 /gene="SGK1" /gene_synonym="SGK" /standard_name="RH102" /db_xref="UniSTS:2151" STS 2104..2278 /gene="SGK1" /gene_synonym="SGK" /standard_name="STS-T33566" /db_xref="UniSTS:55519" STS 2255..2379 /gene="SGK1" /gene_synonym="SGK" /standard_name="WI-13202" /db_xref="UniSTS:71093" polyA_signal 2379..2384 /gene="SGK1" /gene_synonym="SGK" polyA_site 2407 /gene="SGK1" /gene_synonym="SGK" ORIGIN
ttttttataaggccgagcgcgcggcctggcgcagcatacgccgagccggtctttgagcgctaacgtctttctgtctccccgcggtggtgatgacggtgaaaactgaggctgctaagggcaccctcacttactccaggatgaggggcatggtggcaattctcatcgctttcatgaagcagaggaggatgggtctgaacgactttattcagaagattgccaataactcctatgcatgcaaacaccctgaagttcagtccatcttgaagatctcccaacctcaggagcctgagcttatgaatgccaacccttctcctccaccaagtccttctcagcaaatcaaccttggcccgtcgtccaatcctcatgctaaaccatctgactttcacttcttgaaagtgatcggaaagggcagttttggaaaggttcttctagcaagacacaaggcagaagaagtgttctatgcagtcaaagttttacagaagaaagcaatcctgaaaaagaaagaggagaagcatattatgtcggagcggaatgttctgttgaagaatgtgaagcaccctttcctggtgggccttcacttctctttccagactgctgacaaattgtactttgtcctagactacattaatggtggagagttgttctaccatctccagagggaacgctgcttcctggaaccacgggctcgtttctatgctgctgaaatagccagtgccttgggctacctgcattcactgaacatcgtttatagagacttaaaaccagagaatattttgctagattcacagggacacattgtccttactgacttcggactctgcaaggagaacattgaacacaacagcacaacatccaccttctgtggcacgccggagtatctcgcacctgaggtgcttcataagcagccttatgacaggactgtggactggtggtgcctgggagctgtcttgtatgagatgctgtatggcctgccgcctttttatagccgaaacacagctgaaatgtacgacaacattctgaacaagcctctccagctgaaaccaaatattacaaattccgcaagacacctcctggagggcctcctgcagaaggacaggacaaagcggctcggggccaaggatgacttcatggagattaagagtcatgtcttcttctccttaattaactgggatgatctcattaataagaagattactcccccttttaacccaaatgtgagtgggcccaacgacctacggcactttgaccccgagtttaccgaagagcctgtccccaactccattggcaagtcccctgacagcgtcctcgtcacagccagcgtcaaggaagctgccgaggctttcctaggcttttcctatgcgcctcccacggactctttcctctgaaccctgttagggcttggttttaaaggattttatgtgtgtttccgaatgttttagttagccttttggtggagccgccagctgacaggacatcttacaagagaatttgcacatctctggaagcttagcaatcttattgcacactgttcgctggaagctttttgaagagcacattctcctcagtgagctcatgaggttttcatttttattcttccttccaacgtggtgctatctctgaaacgagcgttagagtgccgccttagacggaggcaggagtttcgttagaaagcggacgctgttctaaaaaaggtctcctgcagatctgtctgggctgtgatgacgaatattatgaaatgtgccttttctgaagagattgtgttagctccaaagcttttcctatcgcagtgtttcagttctttattttcccttgtggatatgctgtgtgaaccgtcgtgtgagtgtggtatgcctgatcacagatggattttgttataagcatcaatgtgacacttgcaggacactacaacgtgggacattgtttgtttcttccatatttggaagataaatttatgtgtagacttttttgtaagatacggttaataactaaaatttattgaaatggtcttgcaatgactcgtattcagatgcttaaagaaagcattgctgctacaaatatttctatttttagaaagggtttttatggaccaatgccccagttgtcagtcagagccgttggtgtttttcattgtttaaaatgtcacctgtaaaatgggcattatttatgtttttttttttgcattcctgataattgtatgtattgtataaagaacgtctgtacattgggttataacactagtatatttaaacttacaggcttatttgtaatgtaaaccaccattttaatgtactgtaattaacatggttataatacgtacaatccttccctcatcccatcacacaactttttttgtgtgtgataaactgattttggtttgcaataaaaccttgaaaaatatttacatataaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726): GeneID:6446 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IEA GeneID:6446 -> Molecular function: GO:0005246 [calcium channel regulator activity] evidence: TAS GeneID:6446 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA GeneID:6446 -> Molecular function: GO:0015459 [potassium channel regulator activity] evidence: TAS GeneID:6446 -> Molecular function: GO:0017080 [sodium channel regulator activity] evidence: TAS GeneID:6446 -> Molecular function: GO:0017081 [chloride channel regulator activity] evidence: TAS GeneID:6446 -> Biological process: GO:0001558 [regulation of cell growth] evidence: TAS GeneID:6446 -> Biological process: GO:0006468 [protein phosphorylation] evidence: TAS GeneID:6446 -> Biological process: GO:0006814 [sodium ion transport] evidence: TAS GeneID:6446 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA GeneID:6446 -> Biological process: GO:0006950 [response to stress] evidence: TAS GeneID:6446 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IEA GeneID:6446 -> Biological process: GO:0007616 [long-term memory] evidence: TAS GeneID:6446 -> Biological process: GO:0008217 [regulation of blood pressure] evidence: TAS GeneID:6446 -> Biological process: GO:0030334 [regulation of cell migration] evidence: TAS GeneID:6446 -> Biological process: GO:0032411 [positive regulation of transporter activity] evidence: TAS GeneID:6446 -> Biological process: GO:0034220 [ion transmembrane transport] evidence: TAS GeneID:6446 -> Biological process: GO:0042127 [regulation of cell proliferation] evidence: TAS GeneID:6446 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS GeneID:6446 -> Biological process: GO:0050790 [regulation of catalytic activity] evidence: TAS GeneID:6446 -> Biological process: GO:0051090 [regulation of sequence-specific DNA binding transcription factor activity] evidence: TAS GeneID:6446 -> Biological process: GO:0055085 [transmembrane transport] evidence: TAS GeneID:6446 -> Biological process: GO:0060453 [regulation of gastric acid secretion] evidence: TAS GeneID:6446 -> Biological process: GO:0070294 [renal sodium ion absorption] evidence: TAS GeneID:6446 -> Cellular component: GO:0005634 [nucleus] evidence: IEA GeneID:6446 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA GeneID:6446 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: IEA GeneID:6446 -> Cellular component: GO:0005829 [cytosol] evidence: TAS GeneID:6446 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA ANNOTATIONS from NCBI Entrez Gene (20130726): NP_005618 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.