Home |
Help |
Advanced search
2024-04-26 06:45:40, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_005627 2414 bp mRNA linear PRI 15-JUL-2013
DEFINITION Homo sapiens serum/glucocorticoid regulated kinase 1 (SGK1),
transcript variant 1, mRNA.
ACCESSION NM_005627
VERSION NM_005627.3 GI:163644253
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 2414)
AUTHORS Alamares-Sapuay,J.G., Martinez-Gil,L., Stertz,S., Miller,M.S.,
Shaw,M.L. and Palese,P.
TITLE Serum- and glucocorticoid-regulated kinase 1 is required for
nuclear export of the ribonucleoprotein of influenza A virus
JOURNAL J. Virol. 87 (10), 6020-6026 (2013)
PUBMED 23487453
REMARK GeneRIF: Authors also demonstrate that SGK1 is required for
influenza A virus ribonucleoprotein nuclear export.
REFERENCE 2 (bases 1 to 2414)
AUTHORS Velez Edwards,D.R., Naj,A.C., Monda,K., North,K.E., Neuhouser,M.,
Magvanjav,O., Kusimo,I., Vitolins,M.Z., Manson,J.E.,
O'Sullivan,M.J., Rampersaud,E. and Edwards,T.L.
TITLE Gene-environment interactions and obesity traits among
postmenopausal African-American and Hispanic women in the Women's
Health Initiative SHARe Study
JOURNAL Hum. Genet. 132 (3), 323-336 (2013)
PUBMED 23192594
REFERENCE 3 (bases 1 to 2414)
AUTHORS Miranda,P., Cadaveira-Mosquera,A., Gonzalez-Montelongo,R.,
Villarroel,A., Gonzalez-Hernandez,T., Lamas,J.A., Alvarez de la
Rosa,D. and Giraldez,T.
TITLE The neuronal serum- and glucocorticoid-regulated kinase 1.1 reduces
neuronal excitability and protects against seizures through
upregulation of the M-current
JOURNAL J. Neurosci. 33 (6), 2684-2696 (2013)
PUBMED 23392695
REMARK GeneRIF: Transgenic mice with increased SGK1.1 activity shows
diminished sensitivity to induced seizures.
REFERENCE 4 (bases 1 to 2414)
AUTHORS Raikwar,N.S., Liu,K.Z. and Thomas,C.P.
TITLE A regulated NH2-terminal Sgk1 variant with enhanced function is
expressed in the collecting duct
JOURNAL Am. J. Physiol. Renal Physiol. 303 (11), F1527-F1533 (2012)
PUBMED 23034940
REMARK GeneRIF: Renally expressed Sgk1 isoform, Sgk1_i3, stimulates ENaC
activity when heterologously expressed in collecting duct cells.
REFERENCE 5 (bases 1 to 2414)
AUTHORS Ronchi,C.L., Sbiera,S., Leich,E., Tissier,F., Steinhauer,S.,
Deutschbein,T., Fassnacht,M. and Allolio,B.
TITLE Low SGK1 expression in human adrenocortical tumors is associated
with ACTH-independent glucocorticoid secretion and poor prognosis
JOURNAL J. Clin. Endocrinol. Metab. 97 (12), E2251-E2260 (2012)
PUBMED 23055545
REMARK GeneRIF: Low SGK1 expression is related to ACTH-independent
cortisol secretion in adrenocortical tumors and is a new prognostic
factor in adrenocortical carcinoma.
REFERENCE 6 (bases 1 to 2414)
AUTHORS Kobayashi,T., Deak,M., Morrice,N. and Cohen,P.
TITLE Characterization of the structure and regulation of two novel
isoforms of serum- and glucocorticoid-induced protein kinase
JOURNAL Biochem. J. 344 (PT 1), 189-197 (1999)
PUBMED 10548550
REFERENCE 7 (bases 1 to 2414)
AUTHORS Park,J., Leong,M.L., Buse,P., Maiyar,A.C., Firestone,G.L. and
Hemmings,B.A.
TITLE Serum and glucocorticoid-inducible kinase (SGK) is a target of the
PI 3-kinase-stimulated signaling pathway
JOURNAL EMBO J. 18 (11), 3024-3033 (1999)
PUBMED 10357815
REFERENCE 8 (bases 1 to 2414)
AUTHORS Kobayashi,T. and Cohen,P.
TITLE Activation of serum- and glucocorticoid-regulated protein kinase by
agonists that activate phosphatidylinositide 3-kinase is mediated
by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2
JOURNAL Biochem. J. 339 (PT 2), 319-328 (1999)
PUBMED 10191262
REFERENCE 9 (bases 1 to 2414)
AUTHORS Waldegger,S., Erdel,M., Nagl,U.O., Barth,P., Raber,G., Steuer,S.,
Utermann,G., Paulmichl,M. and Lang,F.
TITLE Genomic organization and chromosomal localization of the human SGK
protein kinase gene
JOURNAL Genomics 51 (2), 299-302 (1998)
PUBMED 9722955
REFERENCE 10 (bases 1 to 2414)
AUTHORS Waldegger,S., Barth,P., Raber,G. and Lang,F.
TITLE Cloning and characterization of a putative human serine/threonine
protein kinase transcriptionally modified during anisotonic and
isotonic alterations of cell volume
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 94 (9), 4440-4445 (1997)
PUBMED 9114008
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from DB450096.1, AK098509.1 and
BP384292.1.
On Dec 20, 2007 this sequence version replaced gi:25168262.
Summary: This gene encodes a serine/threonine protein kinase that
plays an important role in cellular stress response. This kinase
activates certain potassium, sodium, and chloride channels,
suggesting an involvement in the regulation of processes such as
cell survival, neuronal excitability, and renal sodium excretion.
High levels of expression of this gene may contribute to conditions
such as hypertension and diabetic nephropathy. Several
alternatively spliced transcript variants encoding different
isoforms have been noted for this gene. [provided by RefSeq, Jan
2009].
Transcript Variant: This variant (1) represents the predominant
transcript and encodes the shortest isoform (1).
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: AF153609.1, BC001263.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
ERS025081, ERS025082 [ECO:0000350]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-32 DB450096.1 1-32
33-2396 AK098509.1 1-2364
2397-2414 BP384292.1 485-502
FEATURES Location/Qualifiers
source 1..2414
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="6"
/map="6q23"
gene 1..2414
/gene="SGK1"
/gene_synonym="SGK"
/note="serum/glucocorticoid regulated kinase 1"
/db_xref="GeneID:6446"
/db_xref="HGNC:10810"
/db_xref="HPRD:04264"
/db_xref="MIM:602958"
exon 1..165
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
misc_feature 54..56
/gene="SGK1"
/gene_synonym="SGK"
/note="upstream in-frame stop codon"
CDS 90..1385
/gene="SGK1"
/gene_synonym="SGK"
/EC_number="2.7.11.1"
/note="isoform 1 is encoded by transcript variant 1;
serine/threonine protein kinase SGK;
serine/threonine-protein kinase Sgk1;
serum/glucocorticoid-regulated kinase 1; Sgk1 variant i3"
/codon_start=1
/product="serine/threonine-protein kinase Sgk1 isoform 1"
/protein_id="NP_005618.2"
/db_xref="GI:25168263"
/db_xref="CCDS:CCDS5170.1"
/db_xref="GeneID:6446"
/db_xref="HGNC:10810"
/db_xref="HPRD:04264"
/db_xref="MIM:602958"
/translation="
MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEVFYAVKVLQKKAILKKKEEKHIMSERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAEIASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNSTTSTFCGTPEYLAPEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSARHLLEGLLQKDRTKRLGAKDDFMEIKSHVFFSLINWDDLINKKITPPFNPNVSGPNDLRHFDPEFTEEPVPNSIGKSPDSVLVTASVKEAAEAFLGFSYAPPTDSFL
"
misc_feature 90..269
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (O00141.2);
Region: Necessary for localization to the mitochondria"
misc_feature <168..263
/gene="SGK1"
/gene_synonym="SGK"
/note="The Phox Homology domain, a phosphoinositide
binding module; Region: PX_domain; cl02563"
/db_xref="CDD:207644"
misc_feature 309..311
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O00141.2); phosphorylation site"
misc_feature 321..323
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine, by MAPK7; propagated from
UniProtKB/Swiss-Prot (O00141.2); phosphorylation site"
misc_feature 321..323
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:03952"
misc_feature 381..1154
/gene="SGK1"
/gene_synonym="SGK"
/note="Serine/Threonine protein kinases, catalytic domain;
Region: S_TKc; smart00220"
/db_xref="CDD:197582"
misc_feature 393..1367
/gene="SGK1"
/gene_synonym="SGK"
/note="Catalytic domain of the Protein Serine/Threonine
Kinase, Serum- and Glucocorticoid-induced Kinase 1;
Region: STKc_SGK1; cd05602"
/db_xref="CDD:173693"
misc_feature order(399..404,408..419,423..425,462..464,468..470,
567..569,618..620,624..626,636..638,642..644,753..755,
759..761,765..770,774..776,804..809,816..818,858..875,
954..956,972..974,981..983)
/gene="SGK1"
/gene_synonym="SGK"
/note="active site"
/db_xref="CDD:173693"
misc_feature order(399..404,408..419,423..425,462..464,468..470,
567..569,618..620,624..626,759..761,765..770,774..776,
804..806)
/gene="SGK1"
/gene_synonym="SGK"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:173693"
misc_feature order(411..413,636..638,642..644,753..755,759..761,
765..767,816..818,858..875,954..956,972..974,981..983)
/gene="SGK1"
/gene_synonym="SGK"
/note="substrate binding site [chemical binding]; other
site"
/db_xref="CDD:173693"
misc_feature 480..512
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="propagated from UniProtKB/Swiss-Prot (O00141.2);
Region: Nuclear localization signal"
misc_feature 804..875
/gene="SGK1"
/gene_synonym="SGK"
/note="activation loop (A-loop); other site"
/db_xref="CDD:173693"
misc_feature 855..857
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by PDPK1; propagated from
UniProtKB/Swiss-Prot (O00141.2); phosphorylation site"
misc_feature 855..857
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[7]
/citation=[8]
/db_xref="HPRD:05556"
misc_feature 855..857
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[8]
misc_feature 1194..1196
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphothreonine, by PKA; propagated from
UniProtKB/Swiss-Prot (O00141.2); phosphorylation site"
misc_feature 1218..1220
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/db_xref="HPRD:05348"
misc_feature 1278..1280
/gene="SGK1"
/gene_synonym="SGK"
/note="turn motif phosphorylation site [posttranslational
modification]; other site"
/db_xref="CDD:173693"
misc_feature 1278..1280
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O00141.2); phosphorylation site"
misc_feature 1290..1292
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O00141.2); phosphorylation site"
misc_feature 1341..1358
/gene="SGK1"
/gene_synonym="SGK"
/note="hydrophobic motif (HM); other site"
/db_xref="CDD:173693"
misc_feature 1353..1355
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(O00141.2); phosphorylation site"
misc_feature 1353..1355
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[8]
/db_xref="HPRD:05348"
misc_feature 1353..1355
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[8]
/db_xref="HPRD:05556"
misc_feature 1353..1355
/gene="SGK1"
/gene_synonym="SGK"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
/citation=[8]
exon 166..241
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
exon 242..317
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
variation 279
/gene="SGK1"
/gene_synonym="SGK"
/replace="a"
/replace="c"
/db_xref="dbSNP:11554163"
exon 318..422
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
exon 423..506
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
exon 507..638
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
exon 639..751
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
exon 752..875
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
variation 809
/gene="SGK1"
/gene_synonym="SGK"
/replace="c"
/replace="t"
/db_xref="dbSNP:1057293"
STS 812..1029
/gene="SGK1"
/gene_synonym="SGK"
/standard_name="MARC_12229-12230:1007996328:1"
/db_xref="UniSTS:267375"
exon 876..971
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
exon 972..1127
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
variation 976..977
/gene="SGK1"
/gene_synonym="SGK"
/replace="c"
/replace="t"
/db_xref="dbSNP:1057934"
variation 1022
/gene="SGK1"
/gene_synonym="SGK"
/replace="a"
/replace="c"
/db_xref="dbSNP:78176488"
exon 1128..1217
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
exon 1218..2407
/gene="SGK1"
/gene_synonym="SGK"
/inference="alignment:Splign:1.39.8"
STS 1231..1353
/gene="SGK1"
/gene_synonym="SGK"
/standard_name="RH16308"
/db_xref="UniSTS:9291"
variation 1232
/gene="SGK1"
/gene_synonym="SGK"
/replace="c"
/replace="g"
/db_xref="dbSNP:1135343"
variation 1539..1540
/gene="SGK1"
/gene_synonym="SGK"
/replace="g"
/replace="t"
/db_xref="dbSNP:1057300"
variation 1781
/gene="SGK1"
/gene_synonym="SGK"
/replace="a"
/replace="g"
/db_xref="dbSNP:11554162"
STS 1808..2097
/gene="SGK1"
/gene_synonym="SGK"
/standard_name="PMC86685P1"
/db_xref="UniSTS:273543"
STS 1999..2128
/gene="SGK1"
/gene_synonym="SGK"
/standard_name="RH102"
/db_xref="UniSTS:2151"
STS 2104..2278
/gene="SGK1"
/gene_synonym="SGK"
/standard_name="STS-T33566"
/db_xref="UniSTS:55519"
STS 2255..2379
/gene="SGK1"
/gene_synonym="SGK"
/standard_name="WI-13202"
/db_xref="UniSTS:71093"
polyA_signal 2379..2384
/gene="SGK1"
/gene_synonym="SGK"
polyA_site 2407
/gene="SGK1"
/gene_synonym="SGK"
ORIGIN
ttttttataaggccgagcgcgcggcctggcgcagcatacgccgagccggtctttgagcgctaacgtctttctgtctccccgcggtggtgatgacggtgaaaactgaggctgctaagggcaccctcacttactccaggatgaggggcatggtggcaattctcatcgctttcatgaagcagaggaggatgggtctgaacgactttattcagaagattgccaataactcctatgcatgcaaacaccctgaagttcagtccatcttgaagatctcccaacctcaggagcctgagcttatgaatgccaacccttctcctccaccaagtccttctcagcaaatcaaccttggcccgtcgtccaatcctcatgctaaaccatctgactttcacttcttgaaagtgatcggaaagggcagttttggaaaggttcttctagcaagacacaaggcagaagaagtgttctatgcagtcaaagttttacagaagaaagcaatcctgaaaaagaaagaggagaagcatattatgtcggagcggaatgttctgttgaagaatgtgaagcaccctttcctggtgggccttcacttctctttccagactgctgacaaattgtactttgtcctagactacattaatggtggagagttgttctaccatctccagagggaacgctgcttcctggaaccacgggctcgtttctatgctgctgaaatagccagtgccttgggctacctgcattcactgaacatcgtttatagagacttaaaaccagagaatattttgctagattcacagggacacattgtccttactgacttcggactctgcaaggagaacattgaacacaacagcacaacatccaccttctgtggcacgccggagtatctcgcacctgaggtgcttcataagcagccttatgacaggactgtggactggtggtgcctgggagctgtcttgtatgagatgctgtatggcctgccgcctttttatagccgaaacacagctgaaatgtacgacaacattctgaacaagcctctccagctgaaaccaaatattacaaattccgcaagacacctcctggagggcctcctgcagaaggacaggacaaagcggctcggggccaaggatgacttcatggagattaagagtcatgtcttcttctccttaattaactgggatgatctcattaataagaagattactcccccttttaacccaaatgtgagtgggcccaacgacctacggcactttgaccccgagtttaccgaagagcctgtccccaactccattggcaagtcccctgacagcgtcctcgtcacagccagcgtcaaggaagctgccgaggctttcctaggcttttcctatgcgcctcccacggactctttcctctgaaccctgttagggcttggttttaaaggattttatgtgtgtttccgaatgttttagttagccttttggtggagccgccagctgacaggacatcttacaagagaatttgcacatctctggaagcttagcaatcttattgcacactgttcgctggaagctttttgaagagcacattctcctcagtgagctcatgaggttttcatttttattcttccttccaacgtggtgctatctctgaaacgagcgttagagtgccgccttagacggaggcaggagtttcgttagaaagcggacgctgttctaaaaaaggtctcctgcagatctgtctgggctgtgatgacgaatattatgaaatgtgccttttctgaagagattgtgttagctccaaagcttttcctatcgcagtgtttcagttctttattttcccttgtggatatgctgtgtgaaccgtcgtgtgagtgtggtatgcctgatcacagatggattttgttataagcatcaatgtgacacttgcaggacactacaacgtgggacattgtttgtttcttccatatttggaagataaatttatgtgtagacttttttgtaagatacggttaataactaaaatttattgaaatggtcttgcaatgactcgtattcagatgcttaaagaaagcattgctgctacaaatatttctatttttagaaagggtttttatggaccaatgccccagttgtcagtcagagccgttggtgtttttcattgtttaaaatgtcacctgtaaaatgggcattatttatgtttttttttttgcattcctgataattgtatgtattgtataaagaacgtctgtacattgggttataacactagtatatttaaacttacaggcttatttgtaatgtaaaccaccattttaatgtactgtaattaacatggttataatacgtacaatccttccctcatcccatcacacaactttttttgtgtgtgataaactgattttggtttgcaataaaaccttgaaaaatatttacatataaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:6446 -> Molecular function: GO:0004674 [protein serine/threonine kinase activity] evidence: IEA
GeneID:6446 -> Molecular function: GO:0005246 [calcium channel regulator activity] evidence: TAS
GeneID:6446 -> Molecular function: GO:0005524 [ATP binding] evidence: IEA
GeneID:6446 -> Molecular function: GO:0015459 [potassium channel regulator activity] evidence: TAS
GeneID:6446 -> Molecular function: GO:0017080 [sodium channel regulator activity] evidence: TAS
GeneID:6446 -> Molecular function: GO:0017081 [chloride channel regulator activity] evidence: TAS
GeneID:6446 -> Biological process: GO:0001558 [regulation of cell growth] evidence: TAS
GeneID:6446 -> Biological process: GO:0006468 [protein phosphorylation] evidence: TAS
GeneID:6446 -> Biological process: GO:0006814 [sodium ion transport] evidence: TAS
GeneID:6446 -> Biological process: GO:0006915 [apoptotic process] evidence: IEA
GeneID:6446 -> Biological process: GO:0006950 [response to stress] evidence: TAS
GeneID:6446 -> Biological process: GO:0006974 [response to DNA damage stimulus] evidence: IEA
GeneID:6446 -> Biological process: GO:0007616 [long-term memory] evidence: TAS
GeneID:6446 -> Biological process: GO:0008217 [regulation of blood pressure] evidence: TAS
GeneID:6446 -> Biological process: GO:0030334 [regulation of cell migration] evidence: TAS
GeneID:6446 -> Biological process: GO:0032411 [positive regulation of transporter activity] evidence: TAS
GeneID:6446 -> Biological process: GO:0034220 [ion transmembrane transport] evidence: TAS
GeneID:6446 -> Biological process: GO:0042127 [regulation of cell proliferation] evidence: TAS
GeneID:6446 -> Biological process: GO:0042981 [regulation of apoptotic process] evidence: TAS
GeneID:6446 -> Biological process: GO:0050790 [regulation of catalytic activity] evidence: TAS
GeneID:6446 -> Biological process: GO:0051090 [regulation of sequence-specific DNA binding transcription factor activity] evidence: TAS
GeneID:6446 -> Biological process: GO:0055085 [transmembrane transport] evidence: TAS
GeneID:6446 -> Biological process: GO:0060453 [regulation of gastric acid secretion] evidence: TAS
GeneID:6446 -> Biological process: GO:0070294 [renal sodium ion absorption] evidence: TAS
GeneID:6446 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:6446 -> Cellular component: GO:0005739 [mitochondrion] evidence: IEA
GeneID:6446 -> Cellular component: GO:0005789 [endoplasmic reticulum membrane] evidence: IEA
GeneID:6446 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
GeneID:6446 -> Cellular component: GO:0005886 [plasma membrane] evidence: IEA
ANNOTATIONS from NCBI Entrez Gene (20130726):
NP_005618 -> EC 2.7.11.1
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.