GGRNA Home | Help | Advanced search

2019-03-23 03:25:21, GGRNA : RefSeq release 60 (20130726)

LOCUS       NM_005536               3396 bp    mRNA    linear   PRI 14-JUL-2013
DEFINITION  Homo sapiens inositol(myo)-1(or 4)-monophosphatase 1 (IMPA1),
            transcript variant 1, mRNA.
ACCESSION   NM_005536
VERSION     NM_005536.3  GI:221625478
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3396)
  AUTHORS   Pharoah PD, Tsai YY, Ramus SJ, Phelan CM, Goode EL, Lawrenson K,
            Buckley M, Fridley BL, Tyrer JP, Shen H, Weber R, Karevan R, Larson
            MC, Song H, Tessier DC, Bacot F, Vincent D, Cunningham JM, Dennis
            J, Dicks E, Aben KK, Anton-Culver H, Antonenkova N, Armasu SM,
            Baglietto L, Bandera EV, Beckmann MW, Birrer MJ, Bloom G, Bogdanova
            N, Brenton JD, Brinton LA, Brooks-Wilson A, Brown R, Butzow R,
            Campbell I, Carney ME, Carvalho RS, Chang-Claude J, Chen YA, Chen
            Z, Chow WH, Cicek MS, Coetzee G, Cook LS, Cramer DW, Cybulski C,
            Dansonka-Mieszkowska A, Despierre E, Doherty JA, Dork T, du Bois A,
            Durst M, Eccles D, Edwards R, Ekici AB, Fasching PA, Fenstermacher
            D, Flanagan J, Gao YT, Garcia-Closas M, Gentry-Maharaj A, Giles G,
            Gjyshi A, Gore M, Gronwald J, Guo Q, Halle MK, Harter P, Hein A,
            Heitz F, Hillemanns P, Hoatlin M, Hogdall E, Hogdall CK, Hosono S,
            Jakubowska A, Jensen A, Kalli KR, Karlan BY, Kelemen LE, Kiemeney
            LA, Kjaer SK, Konecny GE, Krakstad C, Kupryjanczyk J, Lambrechts D,
            Lambrechts S, Le ND, Lee N, Lee J, Leminen A, Lim BK, Lissowska J,
            Lubinski J, Lundvall L, Lurie G, Massuger LF, Matsuo K, McGuire V,
            McLaughlin JR, Menon U, Modugno F, Moysich KB, Nakanishi T, Narod
            SA, Ness RB, Nevanlinna H, Nickels S, Noushmehr H, Odunsi K, Olson
            S, Orlow I, Paul J, Pejovic T, Pelttari LM, Permuth-Wey J, Pike MC,
            Poole EM, Qu X, Risch HA, Rodriguez-Rodriguez L, Rossing MA,
            Rudolph A, Runnebaum I, Rzepecka IK, Salvesen HB, Schwaab I, Severi
            G, Shen H, Shridhar V, Shu XO, Sieh W, Southey MC, Spellman P,
            Tajima K, Teo SH, Terry KL, Thompson PJ, Timorek A, Tworoger SS,
            van Altena AM, van den Berg D, Vergote I, Vierkant RA, Vitonis AF,
            Wang-Gohrke S, Wentzensen N, Whittemore AS, Wik E, Winterhoff B,
            Woo YL, Wu AH, Yang HP, Zheng W, Ziogas A, Zulkifli F, Goodman MT,
            Hall P, Easton DF, Pearce CL, Berchuck A, Chenevix-Trench G,
            Iversen E, Monteiro AN, Gayther SA, Schildkraut JM and Sellers TA.
  CONSRTM   Australian Cancer Study; Australian Ovarian Cancer Study Group
  TITLE     GWAS meta-analysis and replication identifies three new
            susceptibility loci for ovarian cancer
  JOURNAL   Nat. Genet. 45 (4), 362-370 (2013)
   PUBMED   23535730
REFERENCE   2  (bases 1 to 3396)
  AUTHORS   Singh,N., Halliday,A.C., Knight,M., Lack,N.A., Lowe,E. and
            Churchill,G.C.
  TITLE     Cloning, expression, purification, crystallization and X-ray
            analysis of inositol monophosphatase from Mus musculus and Homo
            sapiens
  JOURNAL   Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 68 (PT 10),
            1149-1152 (2012)
   PUBMED   23027737
  REMARK    GeneRIF: Comparison of MmIMPase 1 and HsIMPase 1 revealed a core
            r.m.s. deviation of 0.516 A
REFERENCE   3  (bases 1 to 3396)
  AUTHORS   Ohnishi,T., Watanabe,A., Ohba,H., Iwayama,Y., Maekawa,M. and
            Yoshikawa,T.
  TITLE     Behavioral analyses of transgenic mice harboring bipolar disorder
            candidate genes, IMPA1 and IMPA2
  JOURNAL   Neurosci. Res. 67 (1), 86-94 (2010)
   PUBMED   20153384
  REMARK    GeneRIF: The current study did not support a substantial role of
            the upregulation of IMPase in bipolar disorder, although the
            lithium-insensitivity trait seen in IMPA2 transgenic mice might
            represent some aspect relevant to the inositol depletion
            hypothesis.
REFERENCE   4  (bases 1 to 3396)
  AUTHORS   Lamesch,P., Li,N., Milstein,S., Fan,C., Hao,T., Szabo,G., Hu,Z.,
            Venkatesan,K., Bethel,G., Martin,P., Rogers,J., Lawlor,S.,
            McLaren,S., Dricot,A., Borick,H., Cusick,M.E., Vandenhaute,J.,
            Dunham,I., Hill,D.E. and Vidal,M.
  TITLE     hORFeome v3.1: a resource of human open reading frames representing
            over 10,000 human genes
  JOURNAL   Genomics 89 (3), 307-315 (2007)
   PUBMED   17207965
REFERENCE   5  (bases 1 to 3396)
  AUTHORS   Ohnishi,T., Ohba,H., Seo,K.C., Im,J., Sato,Y., Iwayama,Y.,
            Furuichi,T., Chung,S.K. and Yoshikawa,T.
  TITLE     Spatial expression patterns and biochemical properties distinguish
            a second myo-inositol monophosphatase IMPA2 from IMPA1
  JOURNAL   J. Biol. Chem. 282 (1), 637-646 (2007)
   PUBMED   17068342
  REMARK    GeneRIF: IMPA2 has a separate function in vivo from that of IMPA1
REFERENCE   6  (bases 1 to 3396)
  AUTHORS   Bone,R., Frank,L., Springer,J.P. and Atack,J.R.
  TITLE     Structural studies of metal binding by inositol monophosphatase:
            evidence for two-metal ion catalysis
  JOURNAL   Biochemistry 33 (32), 9468-9476 (1994)
   PUBMED   8068621
REFERENCE   7  (bases 1 to 3396)
  AUTHORS   Bone,R., Frank,L., Springer,J.P., Pollack,S.J., Osborne,S.A.,
            Atack,J.R., Knowles,M.R., McAllister,G., Ragan,C.I., Broughton,H.B.
            et al.
  TITLE     Structural analysis of inositol monophosphatase complexes with
            substrates
  JOURNAL   Biochemistry 33 (32), 9460-9467 (1994)
   PUBMED   8068620
REFERENCE   8  (bases 1 to 3396)
  AUTHORS   Bone,R., Springer,J.P. and Atack,J.R.
  TITLE     Structure of inositol monophosphatase, the putative target of
            lithium therapy
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 89 (21), 10031-10035 (1992)
   PUBMED   1332026
REFERENCE   9  (bases 1 to 3396)
  AUTHORS   McAllister,G., Whiting,P., Hammond,E.A., Knowles,M.R., Atack,J.R.,
            Bailey,F.J., Maigetter,R. and Ragan,C.I.
  TITLE     cDNA cloning of human and rat brain myo-inositol monophosphatase.
            Expression and characterization of the human recombinant enzyme
  JOURNAL   Biochem. J. 284 (PT 3), 749-754 (1992)
   PUBMED   1377913
REFERENCE   10 (bases 1 to 3396)
  AUTHORS   Hallcher,L.M. and Sherman,W.R.
  TITLE     The effects of lithium ion and other agents on the activity of
            myo-inositol-1-phosphatase from bovine brain
  JOURNAL   J. Biol. Chem. 255 (22), 10896-10901 (1980)
   PUBMED   6253491
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DC375686.1, AF042729.2,
            BC008381.1, AI921211.1, AC090255.4 and DB299262.1.
            On Jan 27, 2009 this sequence version replaced gi:8393607.
            
            Summary: This gene encodes an enyzme that dephosphorylates
            myo-inositol monophosphate to generate free myo-inositol, a
            precursor of phosphatidylinositol, and is therefore an important
            modulator of intracellular signal transduction via the production
            of the second messengers myoinositol 1,4,5-trisphosphate and
            diacylglycerol. This enzyme can also use
            myo-inositol-1,3-diphosphate, myo-inositol-1,4-diphosphate,
            scyllo-inositol-phosphate, glucose-1-phosphate,
            glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate,
            and 2'-AMP as substrates. This enzyme shows magnesium-dependent
            phosphatase activity and is inhibited by therapeutic concentrations
            of lithium. Inhibition of inositol monophosphate hydroylosis and
            subsequent depletion of inositol for phosphatidylinositol synthesis
            may explain the anti-manic and anti-depressive effects of lithium
            administered to treat bipolar disorder. Alternative splicing
            results in multiple transcript variants encoding distinct isoforms.
            A pseudogene of this gene is also present on chromosome 8q21.13.
            [provided by RefSeq, Nov 2009].
            
            Transcript Variant: This variant (1) represents the predominant
            transcript and encodes isoform 1.
            
            Sequence Note: This RefSeq record was created from transcript and
            genomic sequence data because no quality transcript was available
            for the full length of the gene. The extent of this transcript is
            supported by transcript alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AF042729.2, BC008381.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           ERS025084 [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-132               DC375686.1         1-132
            133-2156            AF042729.2         104-2127
            2157-2356           BC008381.1         2123-2322
            2357-2699           AI921211.1         2-344               c
            2700-2969           AC090255.4         36028-36297
            2970-3396           DB299262.1         1-427               c
FEATURES             Location/Qualifiers
     source          1..3396
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="8"
                     /map="8q21.13-q21.3"
     gene            1..3396
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /note="inositol(myo)-1(or 4)-monophosphatase 1"
                     /db_xref="GeneID:3612"
                     /db_xref="HGNC:6050"
                     /db_xref="HPRD:03641"
                     /db_xref="MIM:602064"
     exon            1..103
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     misc_feature    80..82
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /note="upstream in-frame stop codon"
     exon            104..190
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     variation       124
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:465178"
     variation       127
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:459801"
     CDS             128..961
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /EC_number="3.1.3.25"
                     /note="isoform 1 is encoded by transcript variant 1;
                     inositol monophosphatase 1; lithium-sensitive myo-inositol
                     monophosphatase A1; IMP 1; IMPase 1; inositol-1(or
                     4)-monophosphatase 1"
                     /codon_start=1
                     /product="inositol monophosphatase 1 isoform 1"
                     /protein_id="NP_005527.1"
                     /db_xref="GI:5031789"
                     /db_xref="CCDS:CCDS6231.1"
                     /db_xref="GeneID:3612"
                     /db_xref="HGNC:6050"
                     /db_xref="HPRD:03641"
                     /db_xref="MIM:602064"
                     /translation="
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
"
     misc_feature    149..889
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /note="IMPase, inositol monophosphatase and related
                     domains. A family of Mg++ dependent phosphatases,
                     inhibited by lithium, many of which may act on inositol
                     monophosphate substrate. They dephosphorylate inositol
                     phosphate to generate inositol, which may be...; Region:
                     IMPase; cd01639"
                     /db_xref="CDD:30137"
     misc_feature    order(233..235,248..250,266..268,335..340,395..412,
                     782..787)
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /note="active site"
                     /db_xref="CDD:30137"
     misc_feature    order(245..247,251..253,413..418,422..439,593..601,
                     605..607,611..616,641..646,653..655,662..667,674..676,
                     689..709,731..733,743..754)
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:30137"
     misc_feature    401..412
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P29218.1);
                     Region: Substrate binding"
     misc_feature    707..715
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="propagated from UniProtKB/Swiss-Prot (P29218.1);
                     Region: Substrate binding"
     exon            191..324
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     exon            325..429
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     variation       367
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:204777"
     variation       381
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:11549154"
     exon            430..475
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     variation       452
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:204781"
     exon            476..584
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     variation       541
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2230385"
     exon            585..693
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     exon            694..845
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     exon            846..3396
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /inference="alignment:Splign:1.39.8"
     variation       1113
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2955014"
     variation       1916
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1058401"
     variation       1935
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:204798"
     STS             1945..2194
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /standard_name="D8S1976"
                     /db_xref="UniSTS:23879"
     STS             1945..2086
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /standard_name="RH91172"
                     /db_xref="UniSTS:86946"
     variation       1968
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:8176"
     polyA_signal    2142..2147
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
     polyA_site      2173
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
     STS             2214..2322
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /standard_name="SGC35843"
                     /db_xref="UniSTS:60374"
     polyA_signal    2313..2318
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
     polyA_signal    2342..2347
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
     polyA_site      2373
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
     variation       2478
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1135991"
     variation       2480
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1135992"
     variation       2484
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1135993"
     variation       2492
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1135994"
     variation       2494
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1135995"
     variation       2515
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1135997"
     polyA_signal    2676..2681
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
     polyA_site      2698
                     /gene="IMPA1"
                     /gene_synonym="IMP; IMPA"
ORIGIN      
ttttaagggcggaacttcctgttgcgagtagcccctctacctccggaagagacgagtgcggtaacaccgttcacagagctagccggacgtcctccgactcaagatatttgtcaaatattttcagaagatggctgatccttggcaggaatgcatggattatgcagtaactctagcaagacaagctggagaggtagtttgtgaagctataaaaaatgaaatgaatgttatgctgaaaagttctccagttgatttggtaactgctacggaccaaaaagttgaaaaaatgcttatctcttccataaaggaaaagtatccatctcacagtttcattggtgaagaatctgtggcagctggggaaaaaagtatcttaaccgacaaccccacatggatcattgaccctattgatggaacaactaactttgtacatagatttccttttgtagctgtttcaattggctttgctgtaaataaaaagatagaatttggagttgtgtacagttgtgtggaaggcaagatgtacactgccagaaaaggaaaaggtgccttttgtaatggtcaaaaactacaagtttcacaacaagaagatattaccaaatctctcttggtgactgagttgggctcttccagaacaccagagactgtgagaatggttctttctaatatggaaaagcttttttgcattcctgttcatgggatccggagtgttggaacagcagctgttaatatgtgccttgtggcaactggcggagcagatgcatattatgaaatgggaattcactgctgggatgttgcaggagctggcattattgttactgaagctggtggcgtgctaatggatgttacaggtggaccatttgatttgatgtcacgaagagtaattgctgcaaataatagaatattagcagaaaggatagctaaagaaattcaggttatacctttgcaacgagacgacgaagattaattaaggcagcctcatagtcaatcccagttgcttttccccagatttggtgactcatcaatggatatgtgttttggatgtatgatatgcttggtttaaattctctttgtccaggtcaaaaatttggaacttgtttcttattttactatgtctaggtttgcaagaattgacataatgtttgtttcactgatttaaaaaattttgcatgtaagaatgtactttaggaaacatacccaggaagtacagttgataaatataacatcaactgaaatagtcaattagcaattttgtgtttctaaatatctatggtcccctgaaattttgacttagtatataggtgcagagacacccacttagaaagttaactgtttggaaaaacatttctctttagtttcaaaaaccatatataattaaatttgtaaggatatactgagtaccctaggccaacttttttttctttgcagagaaccttttttgttttattcttcagtgttcatatagcacctggcccattacatatctaggcaactaaaaacaaacattgtaagaatgaatatttttaatgtagtaattcctagttacaatagatacataaagtaatgaactcagcattctgtacttttgcttcaggtttgaagtaaaaattatctagttaaattttttttatttcacgttaccatgccatttcacattaccataccatcagatagcatggcttattgtgggcatttctgcagtgaatacattttccaaaacagttaaattgtctgtttggatttgctttaaagtcttgtgtaagagagaagaaactatttctataataaaaagcactctcatcagatatctgacataattagatacaatataacattttactaagttcagtattcatgttttaaaggtgtttatactgatttgattgtgctggcaaatatactgtattgttaatattgaactgtttatttttctcttagtcttcttatttaattaacttcattgccgctggattctgttcagcctttaaaaatatttcttagtggtcattgctctgcagaactcaaaaagaaaattgtacttgttcatagacatttttaaagggttaatttattgttcagccttatcccttggcacgtaaacagactactagacttattgtaggttcgtttgagctttgtgttgtaaaattaaaaatgcttctgtaaagttttcaaggtagggagtgattttattattgtgtatatctaatatattaagtatgtgtgatactaaggtttgactgctataattatttgtactgttgatcacatgtacttaaaacatctgatactgtattctaagacaggttgtttttgcaattaaatttattttaataagacgatcatgaataaaactttaaattgatatttttattattattaccattatcattattattatttttagattcagggtctcgctctgttgcccagggtctgtctctgactgtgctgtggtgcagtcatagctcactgtatccttaaattcctgggctcaagtgatcctcctctttcagtctcctgagtagctgggactataagttcatgccaccatgccctactaatgttttaattttatttttgtaaagatgggatcttcctatgttttccaggccccttggcctcccaaagtgctgggattacagatgtgagccaccgagccaggccatgatatttacattattaaagttaatagttcaaactacttttagaggctttgttttgtttttgttttttgaagacagtgtcttgctcttctgctcaaacagtaatgcagtggcatgatcaccattcattgcagtctcaaccttctgggctcaagcagtcctcccacctcagcctccctagtaactggaaccacaggcacatgccaccatgcctggctaattttttagtttttgtagagacagaatcttcctatgttgcttaggctggtctcattgggctcaagtgatcctcctgcctcagccttctaaagtgctgggattacagatgtgagccattgcacccaacatacttttagaggtttttgtgttgagttacaaatatttgaaacttgcaaatgtaatttaatatatgttcttattttttgcctgtaatctttccaacttttctaaaaacctatatttttttctacaatagcttttccatctgtttattctaaatgcagttgcatattttgtgtctgaaatttctttagatgctgaaaaaggatgatcgacaagtgaattatctaataatatttgaaaatatttctttgagtaacaggacttcttagacttaacatgtatattttgtatcagggtatattatctttctgcatgtggatacatacacagatacatacataaatatacataaatatatgtacttgaacacataaaatatatgtacttgcctttt
//

Annotations:

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:3612 -> Molecular function: GO:0008934 [inositol monophosphate 1-phosphatase activity] evidence: IDA
            GeneID:3612 -> Molecular function: GO:0008934 [inositol monophosphate 1-phosphatase activity] evidence: IMP
            GeneID:3612 -> Molecular function: GO:0042803 [protein homodimerization activity] evidence: IPI
            GeneID:3612 -> Molecular function: GO:0046872 [metal ion binding] evidence: IEA
            GeneID:3612 -> Molecular function: GO:0052832 [inositol monophosphate 3-phosphatase activity] evidence: IEA
            GeneID:3612 -> Molecular function: GO:0052833 [inositol monophosphate 4-phosphatase activity] evidence: IEA
            GeneID:3612 -> Biological process: GO:0006021 [inositol biosynthetic process] evidence: IEA
            GeneID:3612 -> Biological process: GO:0006661 [phosphatidylinositol biosynthetic process] evidence: IMP
            GeneID:3612 -> Biological process: GO:0006796 [phosphate-containing compound metabolic process] evidence: IMP
            GeneID:3612 -> Biological process: GO:0007165 [signal transduction] evidence: IMP
            GeneID:3612 -> Biological process: GO:0043647 [inositol phosphate metabolic process] evidence: TAS
            GeneID:3612 -> Biological process: GO:0044281 [small molecule metabolic process] evidence: TAS
            GeneID:3612 -> Biological process: GO:0046854 [phosphatidylinositol phosphorylation] evidence: IEA
            GeneID:3612 -> Biological process: GO:0046855 [inositol phosphate dephosphorylation] evidence: IDA
            GeneID:3612 -> Cellular component: GO:0005634 [nucleus] evidence: IDA
            GeneID:3612 -> Cellular component: GO:0005730 [nucleolus] evidence: IDA
            GeneID:3612 -> Cellular component: GO:0005737 [cytoplasm] evidence: IDA
            GeneID:3612 -> Cellular component: GO:0005739 [mitochondrion] evidence: IDA
            GeneID:3612 -> Cellular component: GO:0005829 [cytosol] evidence: TAS
ANNOTATIONS from NCBI Entrez Gene (20130726):
            NP_005527 -> EC 3.1.3.25

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.