Home |
Help |
Advanced search
2024-04-16 20:28:08, GGRNA : RefSeq release 60 (20130726)
LOCUS NM_005354 1890 bp mRNA linear PRI 23-MAR-2013
DEFINITION Homo sapiens jun D proto-oncogene (JUND), mRNA.
ACCESSION NM_005354
VERSION NM_005354.4 GI:169234622
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1890)
AUTHORS Gazon,H., Lemasson,I., Polakowski,N., Cesaire,R., Matsuoka,M.,
Barbeau,B., Mesnard,J.M. and Peloponese,J.M. Jr.
TITLE Human T-cell leukemia virus type 1 (HTLV-1) bZIP factor requires
cellular transcription factor JunD to upregulate HTLV-1 antisense
transcription from the 3' long terminal repeat
JOURNAL J. Virol. 86 (17), 9070-9078 (2012)
PUBMED 22696638
REMARK GeneRIF: HTLV-1 bZIP factor(hbz) requires cellular JunD to
upregulate HTLV-1 antisense transcription from the 3' long terminal
repeat.
REFERENCE 2 (bases 1 to 1890)
AUTHORS Nakayama,T., Higuchi,T., Oiso,N., Kawada,A. and Yoshie,O.
TITLE Expression and function of FRA2/JUND in cutaneous T-cell lymphomas
JOURNAL Anticancer Res. 32 (4), 1367-1373 (2012)
PUBMED 22493372
REMARK GeneRIF: results demonstrate the presence of a common oncogenic
cascade initiated by FRA2/JUND in CCR4-expressing mature T-cell
malignancies such as ATLL and CTCLs
REFERENCE 3 (bases 1 to 1890)
AUTHORS Huang,J., Gurung,B., Wan,B., Matkar,S., Veniaminova,N.A., Wan,K.,
Merchant,J.L., Hua,X. and Lei,M.
TITLE The same pocket in menin binds both MLL and JUND but has opposite
effects on transcription
JOURNAL Nature 482 (7386), 542-546 (2012)
PUBMED 22327296
REMARK GeneRIF: crystal structures of human menin in its free form and in
complexes with MLL1 or with JUND, or with an MLL1-LEDGF heterodimer
Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1890)
AUTHORS Zerbini,L.F., de Vasconcellos,J.F., Czibere,A., Wang,Y.,
Paccez,J.D., Gu,X., Zhou,J.R. and Libermann,T.A.
TITLE JunD-mediated repression of GADD45alpha and gamma regulates escape
from cell death in prostate cancer
JOURNAL Cell Cycle 10 (15), 2583-2591 (2011)
PUBMED 21734453
REMARK GeneRIF: Apoptosis induction by dominant negative JunD is due to
induction of growth arrest and DNA damage inducible proteins (GADD)
45 alpha and 45 gamma proteins.
REFERENCE 5 (bases 1 to 1890)
AUTHORS Vanden Bush,T.J. and Bishop,G.A.
TITLE CDK-mediated regulation of cell functions via c-Jun phosphorylation
and AP-1 activation
JOURNAL PLoS ONE 6 (4), E19468 (2011)
PUBMED 21559334
REMARK GeneRIF: CDK4-mediated regulation of cell functions via c-Jun
phosphorylation and AP-1 activation
Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1890)
AUTHORS Franklin,C.C., McCulloch,A.V. and Kraft,A.S.
TITLE In vitro association between the Jun protein family and the general
transcription factors, TBP and TFIIB
JOURNAL Biochem. J. 305 (PT 3), 967-974 (1995)
PUBMED 7848298
REFERENCE 7 (bases 1 to 1890)
AUTHORS Chu,H.M., Tan,Y., Kobierski,L.A., Balsam,L.B. and Comb,M.J.
TITLE Activating transcription factor-3 stimulates 3',5'-cyclic adenosine
monophosphate-dependent gene expression
JOURNAL Mol. Endocrinol. 8 (1), 59-68 (1994)
PUBMED 8152431
REFERENCE 8 (bases 1 to 1890)
AUTHORS Berger,I. and Shaul,Y.
TITLE Structure and function of human jun-D
JOURNAL Oncogene 6 (4), 561-566 (1991)
PUBMED 1903194
REFERENCE 9 (bases 1 to 1890)
AUTHORS Mollinedo,F., Vaquerizo,M.J. and Naranjo,J.R.
TITLE Expression of c-jun, jun B and jun D proto-oncogenes in human
peripheral-blood granulocytes
JOURNAL Biochem. J. 273 (PT 2), 477-479 (1991)
PUBMED 1899335
REFERENCE 10 (bases 1 to 1890)
AUTHORS Nomura,N., Ide,M., Sasamoto,S., Matsui,M., Date,T. and Ishizaki,R.
TITLE Isolation of human cDNA clones of jun-related genes, jun-B and
jun-D
JOURNAL Nucleic Acids Res. 18 (10), 3047-3048 (1990)
PUBMED 2112242
COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The
reference sequence was derived from AK223630.1, AC008397.7 and
CA502969.1.
On Mar 1, 2008 this sequence version replaced gi:102469036.
Summary: The protein encoded by this intronless gene is a member of
the JUN family, and a functional component of the AP1 transcription
factor complex. It has been proposed to protect cells from
p53-dependent senescence and apoptosis. Alternate translation
initiation site usage results in the production of different
isoforms. [provided by RefSeq, Jul 2008].
Sequence Note: This RefSeq record was created from transcript and
genomic sequence data to make the sequence consistent with the
reference genome assembly. The genomic coordinates used for the
transcript record were based on transcript alignments.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-1345 AK223630.1 1-1345
1346-1570 AC008397.7 49357-49581 c
1571-1890 CA502969.1 16-335
FEATURES Location/Qualifiers
source 1..1890
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="19"
/map="19p13.2"
gene 1..1890
/gene="JUND"
/gene_synonym="AP-1"
/note="jun D proto-oncogene"
/db_xref="GeneID:3727"
/db_xref="HGNC:6206"
/db_xref="MIM:165162"
exon 1..1870
/gene="JUND"
/gene_synonym="AP-1"
/inference="alignment:Splign:1.39.8"
CDS 139..1182
/gene="JUND"
/gene_synonym="AP-1"
/note="activator protein 1; JunD-FL isoform"
/codon_start=1
/product="transcription factor jun-D"
/protein_id="NP_005345.3"
/db_xref="GI:102469037"
/db_xref="CCDS:CCDS32959.1"
/db_xref="GeneID:3727"
/db_xref="HGNC:6206"
/db_xref="MIM:165162"
/translation="
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAAALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTSSQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPGELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALKDEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
"
misc_feature 139..909
/gene="JUND"
/gene_synonym="AP-1"
/note="Jun-like transcription factor; Region: Jun;
pfam03957"
/db_xref="CDD:146538"
misc_feature 268..270
/gene="JUND"
/gene_synonym="AP-1"
/note="Region: delta-JunD isoform; alternative AUG
translation initiation site"
misc_feature 889..891
/gene="JUND"
/gene_synonym="AP-1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P17535.3); phosphorylation site"
misc_feature 901..903
/gene="JUND"
/gene_synonym="AP-1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P17535.3); phosphorylation site"
misc_feature 901..903
/gene="JUND"
/gene_synonym="AP-1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 913..915
/gene="JUND"
/gene_synonym="AP-1"
/experiment="experimental evidence, no additional details
recorded"
/note="Phosphoserine; propagated from UniProtKB/Swiss-Prot
(P17535.3); phosphorylation site"
misc_feature 913..915
/gene="JUND"
/gene_synonym="AP-1"
/experiment="experimental evidence, no additional details
recorded"
/note="phosphorylation site"
misc_feature 934..1122
/gene="JUND"
/gene_synonym="AP-1"
/note="bZIP transcription factor; Region: bZIP_1;
pfam00170"
/db_xref="CDD:201054"
misc_feature 940..1023
/gene="JUND"
/gene_synonym="AP-1"
/inference="non-experimental evidence, no additional
details recorded"
/note="propagated from UniProtKB/Swiss-Prot (P17535.3);
Region: Basic motif (By similarity)"
misc_feature 955..1014
/gene="JUND"
/gene_synonym="AP-1"
/note="bZIP basic motif; DNA binding site"
misc_feature 1024..1110
/gene="JUND"
/gene_synonym="AP-1"
/note="Region: leucine zipper"
variation 197
/gene="JUND"
/gene_synonym="AP-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:41478151"
STS 503..583
/gene="JUND"
/gene_synonym="AP-1"
/standard_name="PMC155158P1"
/db_xref="UniSTS:271327"
STS 919..1128
/gene="JUND"
/gene_synonym="AP-1"
/standard_name="JUND"
/db_xref="UniSTS:505726"
variation 1262
/gene="JUND"
/gene_synonym="AP-1"
/replace="a"
/replace="g"
/db_xref="dbSNP:7249"
variation 1283..1284
/gene="JUND"
/gene_synonym="AP-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:41474846"
variation 1290..1291
/gene="JUND"
/gene_synonym="AP-1"
/replace=""
/replace="c"
/db_xref="dbSNP:41352349"
variation 1339
/gene="JUND"
/gene_synonym="AP-1"
/replace="a"
/replace="c"
/db_xref="dbSNP:41521444"
variation 1346..1350
/gene="JUND"
/gene_synonym="AP-1"
/replace=""
/replace="gagggtgcccaggactcggaag"
/db_xref="dbSNP:41506245"
variation 1354
/gene="JUND"
/gene_synonym="AP-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:1126915"
variation 1568
/gene="JUND"
/gene_synonym="AP-1"
/replace="c"
/replace="t"
/db_xref="dbSNP:9413"
STS 1580..1809
/gene="JUND"
/gene_synonym="AP-1"
/standard_name="PMC193924P4"
/db_xref="UniSTS:271766"
STS 1590..1802
/gene="JUND"
/gene_synonym="AP-1"
/standard_name="G15878"
/db_xref="UniSTS:45109"
variation 1722
/gene="JUND"
/gene_synonym="AP-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:41363545"
variation 1732
/gene="JUND"
/gene_synonym="AP-1"
/replace="c"
/replace="g"
/db_xref="dbSNP:41495046"
variation 1769
/gene="JUND"
/gene_synonym="AP-1"
/replace="g"
/replace="t"
/db_xref="dbSNP:15212"
polyA_site 1863
/gene="JUND"
/gene_synonym="AP-1"
polyA_site 1870
/gene="JUND"
/gene_synonym="AP-1"
ORIGIN
aggagccgccgccagtggagggccgggcgctgcggccgcggccggggcgggcgcagggccgagcggacgggggggcgcgggccccccgggaggccgcggccactcccccccgggccggcgcggcgggggaggcggaggatggaaacacccttctacggcgatgaggcgctgagcggcctgggcggcggcgccagtggcagcggcggcagcttcgcgtccccgggccgcttgttccccggggcgcccccgacggccgcggccggcagcatgatgaagaaggacgcgctgacgctgagcctgagtgagcaggtggcggcagcgctcaagcctgcggccgcgccgcctcctacccccctgcgcgccgacggcgcccccagcgcggcaccccccgacggcctgctcgcctctcccgacctggggctgctgaagctggcctcccccgagctcgagcgcctcatcatccagtccaacgggctggtcaccaccacgccgacgagctcacagttcctctaccccaaggtggcggccagcgaggagcaggagttcgccgagggcttcgtcaaggccctggaggatttacacaagcagaaccagctcggcgcgggcgcggccgctgccgccgccgccgccgccgccggggggccctcgggcacggccacgggctccgcgccccccggcgagctggccccggcggcggccgcgcccgaagcgcctgtctacgcgaacctgagcagctacgcgggcggcgccgggggcgcggggggcgccgcgacggtcgccttcgctgccgaacctgtgcccttcccgccgccgccacccccaggcgcgttggggccgccgcgcctggctgcgctcaaggacgagccacagacggtgcccgacgtgccgagcttcggcgagagcccgccgttgtcgcccatcgacatggacacgcaggagcgcatcaaggcggagcgcaagcggctgcgcaaccgcatcgccgcctccaagtgccgcaagcgcaagctggagcgcatctcgcgcctggaagagaaagtgaagaccctcaagagtcagaacacggagctggcgtccacggcgagcctgctgcgcgagcaggtggcgcagctcaagcagaaagtcctcagccacgtcaacagcggctgccagctgctgccccagcaccaggtgcccgcgtactgagtccgcgcgcggggcgcatgcgcggccaccctccccaaggggcgggctcgcgggggggtgtcgtgggcgccccggacttggagagggtgcggccctggggaccccccctccccgagtgtgcccaggaactcagagagggcgcggcccccggggattccccccccccgagggtgcccaggactcgacaagctggaccccctgctcccgggggggcgagcgcatgacccccccgccctcgcgctgcctctttcccccgcgcggccgccccgtgttgcacaaacccgcgcgtctcggctgcccctttgtacaccgcgccgcggaagggggctccgagggggcgcagcctcaaaccctgcctttcctttacttttacttttttttttttttctttggaagagagaagaacagagtgttcgattctgccctatttatgtttctactcgggaacaaacgttggttgtgtgtgtgtgtgttttcttgtgttggttttttaaagaaatgggaagaagaaaaaaaaattctccgcccctttcctcgatctcgctccccccttcggttctttcgaccggtcccccctcccttttttgttctgttttgttttgttttgctacgagtccacattcctgtttgtaatccttggttcgcccggttttctgttttcagtaaagtctcgttacgccagctcggcaaaaaaaaaaaaaaaaaaaa
//
ANNOTATIONS from NCBI Entrez Gene (20130726):
GeneID:3727 -> Molecular function: GO:0003690 [double-stranded DNA binding] evidence: IEA
GeneID:3727 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
GeneID:3727 -> Molecular function: GO:0005515 [protein binding] evidence: IPI
GeneID:3727 -> Molecular function: GO:0016922 [ligand-dependent nuclear receptor binding] evidence: IEA
GeneID:3727 -> Molecular function: GO:0043565 [sequence-specific DNA binding] evidence: IEA
GeneID:3727 -> Molecular function: GO:0044212 [transcription regulatory region DNA binding] evidence: IDA
GeneID:3727 -> Biological process: GO:0002076 [osteoblast development] evidence: IEA
GeneID:3727 -> Biological process: GO:0006357 [regulation of transcription from RNA polymerase II promoter] evidence: TAS
GeneID:3727 -> Biological process: GO:0006366 [transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3727 -> Biological process: GO:0007568 [aging] evidence: IEA
GeneID:3727 -> Biological process: GO:0007623 [circadian rhythm] evidence: IEA
GeneID:3727 -> Biological process: GO:0009416 [response to light stimulus] evidence: IEA
GeneID:3727 -> Biological process: GO:0009612 [response to mechanical stimulus] evidence: IEA
GeneID:3727 -> Biological process: GO:0014070 [response to organic cyclic compound] evidence: IEA
GeneID:3727 -> Biological process: GO:0032496 [response to lipopolysaccharide] evidence: IEA
GeneID:3727 -> Biological process: GO:0043434 [response to peptide hormone stimulus] evidence: IEA
GeneID:3727 -> Biological process: GO:0045669 [positive regulation of osteoblast differentiation] evidence: IEA
GeneID:3727 -> Biological process: GO:0045944 [positive regulation of transcription from RNA polymerase II promoter] evidence: IEA
GeneID:3727 -> Biological process: GO:0071277 [cellular response to calcium ion] evidence: IEA
GeneID:3727 -> Cellular component: GO:0000785 [chromatin] evidence: TAS
GeneID:3727 -> Cellular component: GO:0005634 [nucleus] evidence: IEA
GeneID:3727 -> Cellular component: GO:0043234 [protein complex] evidence: IEA
by
@meso_cacase at
DBCLS
This page is licensed under a Creative Commons Attribution 2.1 Japan License.