LOCUS       NM_005193                855 bp    mRNA    linear   PRI 18-APR-2013
DEFINITION  Homo sapiens caudal type homeobox 4 (CDX4), mRNA.
ACCESSION   NM_005193
VERSION     NM_005193.1  GI:4885126
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 855)
  AUTHORS   Bei,L., Shah,C., Wang,H., Huang,W., Roy,R. and Eklund,E.A.
  TITLE     beta-Catenin activates the HOXA10 and CDX4 genes in myeloid
            progenitor cells
  JOURNAL   J. Biol. Chem. 287 (47), 39589-39601 (2012)
   PUBMED   23038246
  REMARK    GeneRIF: a molecular mechanisms through which increased expression
            of HoxA10 increases Cdx4 expression by direct CDX4 activation and
            by Fgf2-induced beta-catenin activity. This results in Cdx4-induced
            HoxA10-expression, creating a positive feedback mechanism
REFERENCE   2  (bases 1 to 855)
  AUTHORS   Szoke,K., Beckstrom,K.J. and Brinchmann,J.E.
  TITLE     Ectopic expression of CDX4 in human mesenchymal stem cells does not
            affect HOX gene expression or induce hematopoietic reprogramming
  JOURNAL   Stem Cell Res 9 (2), 135-142 (2012)
   PUBMED   22721648
  REMARK    GeneRIF: CDX4 gene was introduced to reprogram adipose tissue
            derived mesenchymal stem cells to differentiate along the
            hematopoietic lineage.
REFERENCE   3  (bases 1 to 855)
  AUTHORS   Bei,L., Huang,W., Wang,H., Shah,C., Horvath,E. and Eklund,E.
  TITLE     HoxA10 activates CDX4 transcription and Cdx4 activates HOXA10
            transcription in myeloid cells
  JOURNAL   J. Biol. Chem. 286 (21), 19047-19064 (2011)
   PUBMED   21471217
  REMARK    GeneRIF: positive feedback relationship between HoxA10 and Cdx4,
            which potentially amplified the contribution of either
            transcription factor to the pathogenesis of AML.
REFERENCE   4  (bases 1 to 855)
  AUTHORS   Lengerke,C., Grauer,M., Niebuhr,N.I., Riedt,T., Kanz,L., Park,I.H.
            and Daley,G.Q.
  TITLE     Hematopoietic development from human induced pluripotent stem cells
  JOURNAL   Ann. N. Y. Acad. Sci. 1176, 219-227 (2009)
   PUBMED   19796250
REFERENCE   5  (bases 1 to 855)
  AUTHORS   Yamamichi,N., Inada,K., Furukawa,C., Sakurai,K., Tando,T.,
            Ishizaka,A., Haraguchi,T., Mizutani,T., Fujishiro,M., Shimomura,R.,
            Oka,M., Ichinose,M., Tsutsumi,Y., Omata,M. and Iba,H.
  TITLE     Cdx2 and the Brm-type SWI/SNF complex cooperatively regulate villin
            expression in gastrointestinal cells
  JOURNAL   Exp. Cell Res. 315 (10), 1779-1789 (2009)
   PUBMED   19371634
REFERENCE   6  (bases 1 to 855)
  AUTHORS   Frohling,S., Scholl,C., Bansal,D. and Huntly,B.J.
  TITLE     HOX gene regulation in acute myeloid leukemia: CDX marks the spot?
  JOURNAL   Cell Cycle 6 (18), 2241-2245 (2007)
   PUBMED   17881901
  REMARK    Review article
REFERENCE   7  (bases 1 to 855)
  AUTHORS   Bansal,D., Scholl,C., Frohling,S., McDowell,E., Lee,B.H.,
            Dohner,K., Ernst,P., Davidson,A.J., Daley,G.Q., Zon,L.I.,
            Gilliland,D.G. and Huntly,B.J.
  TITLE     Cdx4 dysregulates Hox gene expression and generates acute myeloid
            leukemia alone and in cooperation with Meis1a in a murine model
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 103 (45), 16924-16929 (2006)
   PUBMED   17068127
REFERENCE   8  (bases 1 to 855)
  AUTHORS   Zambidis,E.T., Peault,B., Park,T.S., Bunz,F. and Civin,C.I.
  TITLE     Hematopoietic differentiation of human embryonic stem cells
            progresses through sequential hematoendothelial, primitive, and
            definitive stages resembling human yolk sac development
  JOURNAL   Blood 106 (3), 860-870 (2005)
   PUBMED   15831705
REFERENCE   9  (bases 1 to 855)
  AUTHORS   Lohnes,D.
  TITLE     The Cdx1 homeodomain protein: an integrator of posterior signaling
            in the mouse
  JOURNAL   Bioessays 25 (10), 971-980 (2003)
   PUBMED   14505364
  REMARK    Review article
REFERENCE   10 (bases 1 to 855)
  AUTHORS   Horn,J.M. and Ashworth,A.
  TITLE     A member of the caudal family of homeobox genes maps to the
            X-inactivation centre region of the mouse and human X chromosomes
  JOURNAL   Hum. Mol. Genet. 4 (6), 1041-1047 (1995)
   PUBMED   7655457
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AF029879.1.
            
            Summary: This gene encodes a member of a small subfamily of
            homeobox containing transcription factors. The encoded protein may
            regulate homeobox gene expression during anteroposterior patterning
            and hematopoiesis. [provided by RefSeq, Aug 2012].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC128233.1 [ECO:0000332]
            ##Evidence-Data-END##
FEATURES             Location/Qualifiers
     source          1..855
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="X"
                     /map="Xq13.2"
     gene            1..855
                     /gene="CDX4"
                     /note="caudal type homeobox 4"
                     /db_xref="GeneID:1046"
                     /db_xref="HGNC:1808"
                     /db_xref="HPRD:02065"
                     /db_xref="MIM:300025"
     CDS             1..855
                     /gene="CDX4"
                     /note="caudal type homeobox transcription factor 4;
                     caudal-type homeobox protein 4"
                     /codon_start=1
                     /product="homeobox protein CDX-4"
                     /protein_id="NP_005184.1"
                     /db_xref="GI:4885127"
                     /db_xref="CCDS:CCDS14424.1"
                     /db_xref="GeneID:1046"
                     /db_xref="HGNC:1808"
                     /db_xref="HPRD:02065"
                     /db_xref="MIM:300025"
                     /translation="

MYGSCLLEKEAGMYPGTLMSPGGDGTAGTGGTGGGGSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLGPVGGGTSGSSLPGQAGGSLVPTDAGAAKASSPSRSRHSPYAWMRKTVQVTGKTRTKEKYRVVYTDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERKMIKKKISQFENSGGSVQSDSDSISPGELPNTFFTTPSAVRGFQPIEIQQVIVSE

"
     misc_feature    154..513
                     /gene="CDX4"
                     /note="Caudal like protein activation region; Region:
                     Caudal_act; pfam04731"
                     /db_xref="CDD:147075"
     misc_feature    523..693
                     /gene="CDX4"
                     /note="Homeodomain;  DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:28970"
     misc_feature    order(523..534,538..540,589..591,607..609,646..648,
                     652..657,664..669,673..681,685..690)
                     /gene="CDX4"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:28970"
     misc_feature    order(526..528,535..537,655..657,664..669,676..678)
                     /gene="CDX4"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:28970"
     exon            1..502
                     /gene="CDX4"
                     /inference="alignment:Splign:1.39.8"
     variation       38
                     /gene="CDX4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:375681941"
     variation       45
                     /gene="CDX4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:367670478"
     variation       66
                     /gene="CDX4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:199592731"
     variation       73
                     /gene="CDX4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:370175012"
     variation       83
                     /gene="CDX4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:150836467"
     variation       172
                     /gene="CDX4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:373883804"
     variation       200
                     /gene="CDX4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:145092385"
     variation       203
                     /gene="CDX4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:368078652"
     variation       205
                     /gene="CDX4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:372222815"
     variation       211
                     /gene="CDX4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201550677"
     variation       221
                     /gene="CDX4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149578736"
     variation       239
                     /gene="CDX4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:200133821"
     variation       240
                     /gene="CDX4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:111725575"
     variation       252
                     /gene="CDX4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146093321"
     variation       313
                     /gene="CDX4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:140116090"
     variation       360
                     /gene="CDX4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:143815058"
     variation       378
                     /gene="CDX4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:146389652"
     variation       414
                     /gene="CDX4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:148593166"
     exon            503..648
                     /gene="CDX4"
                     /inference="alignment:Splign:1.39.8"
     variation       557
                     /gene="CDX4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:377257604"
     exon            649..855
                     /gene="CDX4"
                     /inference="alignment:Splign:1.39.8"
     variation       675
                     /gene="CDX4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:371721540"
     variation       731
                     /gene="CDX4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151132225"
     variation       739
                     /gene="CDX4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:202058995"
     variation       796
                     /gene="CDX4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:199967021"
     variation       809
                     /gene="CDX4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:140658145"
ORIGIN      

atgtacggaagctgtcttttggagaaagaagcaggcatgtacccgggcactctcatgagccctgggggcgacggcacagctgggacaggcggcacagggggcggtgggagtccgatgccagcctccaatttcgctgcggcaccggctttctcgcactatatggggtatcctcatatgcccagcatggatcctcactggccgtctctgggagtctggggctcaccctacagtcccccgcgagaagactggagcgtgtatcctgggccgtctagtacaatgggcacagtgccggtgaacgacgtgacctctagccccgccgctttctgctcgaccgactacagcaacttgggccctgtgggcggtggaactagcggcagcagcctaccaggccaggctggcgggtcgcttgtcccgacggacgcaggcgccgccaaggccagttcccccagcaggagccgccacagcccctatgcatggatgcgcaagacggtgcaggtgacggggaaaaccaggacaaaagaaaagtatcgtgtagtttacactgatcatcaaagattggagctggaaaaggaattccattgcaatagatatatcaccatccagagaaaatcagagctggcagttaacctgggcctttccgagagacaggtgaaaatctggtttcagaatcgcagagccaaggagagaaagatgatcaaaaagaaaatctcccagtttgagaatagtggaggctcggtgcaaagtgactctgactccatcagccctggggaactacctaacacttttttcaccacaccatctgctgttcgtggatttcaacctattgagatacagcaggttatagtctccgaatga

//

ANNOTATIONS from NCBI Entrez Gene (20130726):
            GeneID:1046 -> Molecular function: GO:0000976 [transcription regulatory region sequence-specific DNA binding] evidence: IEA
            GeneID:1046 -> Molecular function: GO:0003700 [sequence-specific DNA binding transcription factor activity] evidence: IEA
            GeneID:1046 -> Biological process: GO:0000122 [negative regulation of transcription from RNA polymerase II promoter] evidence: IEA
            GeneID:1046 -> Biological process: GO:0001568 [blood vessel development] evidence: IEA
            GeneID:1046 -> Biological process: GO:0006351 [transcription, DNA-dependent] evidence: IEA
            GeneID:1046 -> Biological process: GO:0009952 [anterior/posterior pattern specification] evidence: IEA
            GeneID:1046 -> Biological process: GO:0060711 [labyrinthine layer development] evidence: IEA
            GeneID:1046 -> Cellular component: GO:0005634 [nucleus] evidence: IEA